1NCT


Conserved Protein Domain Family
IgI_Titin_like

?
cd05747: IgI_Titin_like 
Click on image for an interactive view with Cn3D
Immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins; member of the I-set of Ig superfamily (IgSF) domains
The members here are composed of the fifth immunoglobulin (Ig)-like domain from the C-terminus of human titin x and similar proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. This group belongs to the I-set of IgSF domains, having A-B-E-D strands in one beta-sheet and A'-G-F-C-C' in the other. Like the V-set Ig domains, members of the I-set have a discontinuous A strand, but lack a C" strand.
Statistics
?
PSSM-Id: 143224
View PSSM: cd05747
Aligned: 3 rows
Threshold Bit Score: 168.688
Threshold Setting Gi: 157832088
Created: 17-Aug-2007
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 8 residues -Click on image for an interactive view with Cn3D
Feature 1:Ig strand A [structural motif]
Evidence:
  • None

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1         ########                                                                      
1NCT_A       12 TLAARILTKPRSMTVYEGESARFSCDTDGEPVPTVTWLRKGQVLSTSARHQVTTTKYKSTFEISSVQASDEGNYSVVVEN 91    human
CAD60685  21358 TLPATILTKPQSLTVSEGESVKFTCDVDGEPAPSVTWMREAQIIVSSQRHLITSTEYKSTFEINKVEMSDGGNYTVVVEN 21437 zebrafish
BAA11678    325 TLPATILTKPRSITVSEGETARFSCDVDGEPAPTITWVRAGQPIVSSRRFQITRTQYKSTFEISLVQIADEGSYTVVVEN 404   chicken
Feature 1                   
1NCT_A       92 SEGKQEAEFTLT 103   human
CAD60685  21438 SEGKQEAQFSLT 21449 zebrafish
BAA11678    405 SEGRQEAHFTLT 416   chicken

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap