1CS6,2OM5


Conserved Protein Domain Family
Ig4_Contactin-2-like

?
cd05728: Ig4_Contactin-2-like 
Click on image for an interactive view with Cn3D
Fourth Ig domain of the neural cell adhesion molecule contactin-2, and similar domains
The members here are composed of the fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (also called TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Statistics
?
PSSM-Id: 143205
View PSSM: cd05728
Aligned: 5 rows
Threshold Bit Score: 172.4
Threshold Setting Gi: 31980846
Created: 26-Jun-2007
Updated: 17-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 4 residues -Click on image for an interactive view with Cn3D
Feature 1:domain-domain interface [polypeptide binding site]
Evidence:
  • Structure:1CS6; Gallus gallus axonin-1 Ig1 and Ig4 interaction, contacts based on 3.5 A distance.
    View structure with Cn3D
  • Comment:Anoxin-1 domains Ig1 and Ig4 interact with each other, helping to form the U-shaped axonin structure.

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                       #                              # #             
1CS6_A     296 DWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQPLASQNRIEVSGGELRFSKLVLEDSGMYQCVAENKHGTVYAS 375  chicken
2OM5_A     295 EWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYAS 374  human
CAF96909   297 QWVHTPKDADIAIGASLQWECKAMGNPRPAYKWLKNGQILPKEGEIYVEAGKLSITRISLSDSGMYQCVAHNEHGSVYAS 376  Tetraodon nigrov...
NP_059079  319 EWEQKIQNTYLSIYDSLFWECKASGNPNPSYTWLKNGQRLNTEERIQIENGTLIITMLNISDSGIYQCAAENKYQTIYAN 398  house mouse
AAI29987   328 EWLKVISDTEADIGSNLRWGCAAAGKPRPTVRWLRNGEPLASQNRVEVLAGDLRFSKLSLEDSGMYQCVAENKHGTIYAS 407  human
Feature 1       #   
1CS6_A     376 AELTV 380  chicken
2OM5_A     375 AELAV 379  human
CAF96909   377 AELKV 381  Tetraodon nigroviridis
NP_059079  399 AELRV 403  house mouse
AAI29987   408 AELAV 412  human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap