Conserved Protein Domain Family
Bromo_polybromo_I

?
cd05524: Bromo_polybromo_I 
Bromodomain, polybromo repeat I. Polybromo is a nuclear protein of unknown function, which contains 6 bromodomains. The human ortholog BAF180 is part of a SWI/SNF chromatin-remodeling complex, and it may carry out the functions of Yeast Rsc-1 and Rsc-2. It was shown that polybromo bromodomains bind to histone H3 at specific acetyl-lysine positions. Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine, but not all the bromodomains in polybromo may bind to acetyl-lysine.
Statistics
?
PSSM-Id: 99954
View PSSM: cd05524
Aligned: 11 rows
Threshold Bit Score: 176.37
Threshold Setting Gi: 7301208
Created: 13-Sep-2006
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
 
putative
Feature 1:putative acetyllysine binding site [chemical binding site]
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                           #    #  #                                     
951231         45 VDPIAVCHELYNTIRDYKDE--QGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNVLTADFQLLFN 122  chicken
AAP34197       44 VDPIAVCHELYNTIRDYKDE--QGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLFN 121  human
CAC70156       33 LHDLRQCAELVDALRSYRTA--DNRILCESFIRAPSRRTDPKYFDVVTHPIDLTRIQQKIKTEEYSSVEDLSADVRLLVN 110  agent of lymp...
XP_625055      80 LDPSDLCQQLYDVLRNQKRE--DGTLLCDAFIRVPKRRQEPGYYDVVTNPIDLLKVQQKLRTDEYRDMDDLAADIQLMVN 157  honey bee
AAH84946      100 VDPIAVCHELYNTIRDYKDE--QGRILCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVRLLTADFQLLFQ 177  African clawe...
AAH78299       43 VDQIAVCHELYNTVRDYKDD--QGRQICELFVRAPKRRNQPDYYEIVSQPIDMMKIQQKLRAEEYQDVEQFSADFHLLIN 120  zebrafish
AAF56339       46 LDPTELCQQLYDSIRNIKKE--DGSMLCDTFIRVPKRRQEPSYYDVVVNPIDLLKVQQKLKTDSYDDLDDLMADLELLIG 123  fruit fly
18958139       40 EFEMAKGNYVMAQIRKHRSSa-GNNSVFESFLRLPPRRFEPEYYEQVKEPIDVTTIQHKLKIPEYLTYDQFNDDFMMFIK 118  Caenorhabditi...
XP_001626082   12 LDPTDLCSELYEAIRNYRSE--DGRVLCEAFIRVPKRRSSPEYYDVISTPIDLLKIQQRLKTDEYEDVGTFTADMELLLD 89   starlet sea a...
XP_796375      37 NDPGEVIQELYDIIRNYKNE--EGKIICEALIRIPKRRTTPEYYEVVSNPIDMLKIQQRMKTEEYDTVDDMVVDVELMIN 114  purple urchin
XP_001666850   40 EIELVKGNYVMSKIRRQRSTagTNEPIFESFLRVPSRRLEPEYYEAVKEPIDITTIQHKLKNPDYQTFDQFQSDFDTFIS 119  Caenorhabditi...
Feature 1          #   #     #                       
951231        123 NAKAYYKPDSPEYKAACKLWELYLRTKNEFVQKGD 157  chicken
AAP34197      122 NAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGE 156  human
CAC70156      111 NNKTYYKEGSQEYKDACELWELFESHRKEMLGNAS 145  agent of lymphatic filariasis
XP_625055     158 NAKAFYMRTSPEYKDATELWELCINTKNRIMEEYE 192  honey bee
AAH84946      178 NTKAYYKPESPEYKAACKLWDLYVRTRNEFVQKGE 212  African clawed frog
AAH78299      121 NTKAYYQADSAEHRAASKLLNVFLSAKNELLQGGD 155  zebrafish
AAF56339      124 NAKAFYIPGSSEHQDAVSLWQHIHSQRQRIMEANG 158  fruit fly
18958139      119 NNLTYYKDESEEHKDMMKIQELFEAATAKVKSGEY 153  Caenorhabditis elegans
XP_001626082   90 NALKYYKPDSQEYQDATQLKQVFDELKEEQGSGDN 124  starlet sea anemone
XP_796375     115 NAQAYYEKNSKEHKDAIELWTVFLQSRRELLEGSE 149  purple urchin
XP_001666850  120 NNLAYYQKDSDEHKDMLKIQELYNAACEKVDSGEY 154  Caenorhabditis briggsae AF16

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap