2OSS,2NXB,2RFJ,1X0J


Conserved Protein Domain Family
Bromo_Brdt_I_like

?
cd05497: Bromo_Brdt_I_like 
Click on image for an interactive view with Cn3D
Bromodomain, Brdt_like subfamily, repeat I. Human Brdt is a testis-specific member of the BET subfamily of bromodomain proteins; the first bromodomain in Brdt has been shown to be essential for male germ cell differentiation. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.
Statistics
?
PSSM-Id: 99929
View PSSM: cd05497
Aligned: 15 rows
Threshold Bit Score: 191.481
Threshold Setting Gi: 47210344
Created: 13-Sep-2006
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
 
acetyllysine
Conserved site includes 6 residues -Click on image for an interactive view with Cn3D
Feature 1:acetyllysine binding site
Evidence:

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                                      #      #  #                                      # 
2OSS_A         17 RQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCY 96   human
2RFJ_A          9 RLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCY 88   human
CAF96012       19 RATNQLSYLERVVIKALWRHPFSWPFQQPVDAVALGLLDYYTVITNPMDLSTITKRLKNKYYWQASECIQDLNTMFSNCY 98   Tetraodon nig...
NP_001025845   27 RVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWGAAECMQDFNTMFTNCY 106  chicken
2554915        27 RLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLKLPDYYTIIKNPMDLNTIKKRLENKYYAKASECIEDFNTMFSNCY 106  human
AAX27484       27 ITTNQLEYIKKEVVGRLFKEKIVWPFTKPVDHQRLNLPDYPKIIKHPMDLGTIKQRLNLKFYHSSSECLDDLFTMFRNCY 106  Schistosoma j...
22265870      282 RHTNCLDFVLFTVVKDALKHKHSWPFQLPVDAIKLEIPEYHNIVNTPMDLRTIEKRLRNLYYWCAEDAIKDINQVFINCY 361  Caenorhabditi...
AAF46312       34 RNTNQLQYLIKTVMKVIWKHHFSWPFQQPVDAKKLNLPDYHKIIKQPMDMGTIKKRLENNYYWSAKETIQDFNTMFNNCY 113  fruit fly
XP_001195742   20 RQTNQLQYLQKVVMKALWKHQFAWPFHHPVDPTKLALLDYLKIIKTPMDLGTIKKRLESIYYHSAKECISDFNLVFTNCY 99   purple urchin
XP_001623945   14 RTTNQLQFLLKTVLKGLWRHHHAWPFREPVDAVKLNLPDYHTIIKKPMDLGTIKKKLENNEYPCAQECIEDFRLMINNCY 93   starlet sea a...
Feature 1           #         #                  
2OSS_A         97 IYNKPG----DDIVLMAEALEKLFLQKINEL 123  human
2RFJ_A         89 LYNKPG----DDIVLMAQALEKLFMQKLSQM 115  human
CAF96012       99 AYNEIKkslkRKLASSPLTPSPVASSQVSPR 129  Tetraodon nigroviridis
NP_001025845  107 IYNKPT----DDIVLMAQTLEKIFLQKVAQM 133  chicken
2554915       107 LYNKPG----DDIVLMAQALEKLFMQKLSQM 133  human
AAX27484      107 IFNKPG----DDVVAMAMKLEQIARERLKFM 133  Schistosoma japonicum
22265870      362 SFNPPE----YDVYKMAKTLEKQVLSQLTQL 388  Caenorhabditis elegans
AAF46312      114 VYNKPG----EDVVVMAQTLEKVFLQKIESM 140  fruit fly
XP_001195742  100 LHNKPG----EDVVFMAQALEKLFLTKVAQM 126  purple urchin
XP_001623945   94 TYNKPG----DDIVLMCQSMDKLFHQKIAMM 120  starlet sea anemone

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap