Conserved Protein Domain Family

cd04130: Wrch_1 
Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho family GTPase similar to Cdc42
Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42. Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation. Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function. The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells. Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes. The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases. Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid. Lipid binding is essential for membrane attachment, a key feature of most Rho proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
PSSM-Id: 133330
Aligned: 10 rows
Threshold Bit Score: 294.695
Threshold Setting Gi: 66772305
Created: 23-Jun-2005
Updated: 2-Oct-2020
Aligned Rows:
  next features
Feature 1:GTP/Mg2+ binding site [chemical binding site]
  • Comment:Rho molecules assume an active conformation when bound to GTP and inactive when GTP is hydrolyzed to GDP
  • Comment:Mg2+ ion plays a key role in bringing together the functional regions of the phosphate-binding, switches I and II
  • Citation:PMID 9545299

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
Feature 1                 ######                                      ## #                       
Feature 1                                                                  # #                   
Feature 1                              ##                
NP_505686    134 VTQLRGKALADRLGA-EFFECSALTQHNLKQMFDAAILAG 172 Caenorhabditis elegans

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap