1Z06


Conserved Protein Domain Family
Rab33B_Rab33A

?
cd04115: Rab33B_Rab33A 
Click on image for an interactive view with Cn3D
Rab GTPase family 33 includes Rab33A and Rab33B
Rab33B/Rab33A subfamily. Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II. Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells. In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state. Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Statistics
?
PSSM-Id: 133315
View PSSM: cd04115
Aligned: 11 rows
Threshold Bit Score: 287.412
Threshold Setting Gi: 47218434
Created: 9-Aug-2005
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
  next features
Conserved site includes 18 residues -Click on image for an interactive view with Cn3D
Feature 1:GTP/Mg2+ binding site [chemical binding site]
Evidence:
  • Comment:The active conformation of Rab is stabilized by interations between the gamma phosphate of GTP and two critically conserved residues, Thr in switch I and Gly in switch II
  • Structure:1Z06: Mus musculus Rab33 binds GppNHp, a GTP analog and Mg2+, defined using 3.5 A contacts
    View structure with Cn3D

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Feature 1                  #######         #   #  #                         #                    
1Z06_A        19 RIFKIIVIGDSNVGKTCLTYRFCAGRFPDRTEATIGVDFRERAVDIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVV 98  house mouse
P91580        14 RVFKIIVIGDSDVGKTCLTYRFCTGKFPEKTEATIGVDFRERTLDIDGEQIKLQLWDTAGQERFRKSMVPHYYRNVHAVV 93  Ciona intestinalis
AAH59345      31 RIFKIIVIGDSNVGKTCLTYRFCTSCFPERTEATIGVDFRERTVDIDGERIKIQLWDTAGQERFRKSMVHHYYRNVHAVV 110 African clawed ...
Q20365        99 RTFKVIIVGNAAVGKTCLSFRFCCGRFPEHTEATIGVDFRERSCVIENELLRVQLWDTAGQERYRQSIVAHYYRNVNAVV 178 Caenorhabditis ...
AAH75228      16 RIFKIIVIGDSNVGKTCLTFRFCGGGFPGSSEATIGVDFREKTVEIDGEKIKVQVWDTAGQERFRHSLVEHYYRNVHGVV 95  African clawed ...
AAH36064      32 RIFKIIVIGDSNVGKTCLTYRFCAGRFPDHTEATIGVDFRERAVEIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVV 111 human
NP_001008466  30 RIFKIIVIGDSNVGKTCLTYRFCAGRFPQRTEATIGVDFRERAVTIDGERIKIQLWDTAGQERFRKSMVQHYYRNVHAVV 109 chicken
AAI00132      25 RIFKIIVIGDSGVGKTCLTYRFCAGKFPDKTEATIGVDFREKVIEIDGEKIKVQLWDTAGQERFRKSMVQHYYRNVHAVV 104 zebrafish
NP_001007418  35 RVFKIIVIGDSNVGKTCLTYRFCGGKFLSNPEATIGVDFRERTLQLDGENIKLQIWDTAGQERFRKSMVEHYYRNVHAII 114 zebrafish
CAG03706      31 RTFKVVVIGDSGVGKTCLTHRLCAGEFPRRVEATIGVDFRERLLNVDGENIKLQLWDTAGQERFRKSMVQHYYRNVHAVL 110 Tetraodon nigro...
Q14088        35 RIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIGVDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVV 114 human
Feature 1                                              ## ##                                     
1Z06_A        99 FVYDMTNMASFHSLPAWIEECKQHlla--ndIPRILVGNKCDLrs--------------aIQVPTDLAQKFADTHs-mPL 161 house mouse
P91580        94 FTYDVTKGRSFQGLPSWIEECERYsln-aseIPRILVGNKCDLkd--------------qAEVDTNSATRFADANs-mPL 157 Ciona intestinalis
AAH59345     111 FVYDITNMASFQSLPAWIEECKQHlis--ndVPRILVGNKCDLla--------------cIQVPTDMAQKFADSHs-mPM 173 African clawed ...
Q20365       179 FVYDVTCRESFNDLALWIKECEKHglvgdseVPRILIGNKCDVec--------------tNRVSTDEAQMFADRNn-mAL 243 Caenorhabditis ...
AAH75228      96 FVYDVTKLSSFHNLRTWLQECEGHavp--alVPRVLVGNKCDLle--------------qVEVPSGLALNFAKAHk-mVL 158 African clawed ...
AAH36064     112 FVYDMTNMASFHSLPSWIEECKQHlla--ndIPRILVGNKCDLrs--------------aIQVPTDLAQKFADTHs-mPL 174 human
NP_001008466 110 FVYDMTNLASFHSLPSWIEECKQHllt--ndIPRILVGNKCDLrn--------------aIQVPTDLAQKFADTHs-mPL 172 chicken
AAI00132     105 FVYDVTNAASFRSLPAWIEECRQHalg--qeVPRILVGNKCDLrh--------------aAQVSTDVAQQFADTHs-mPL 167 zebrafish
NP_001007418 115 FVYDVTSLASFESLPEWIEECNHHsvp--pmVPRILVGNKCDLre--------------sREVSTFLAQRLADSYn-fPL 177 zebrafish
CAG03706     111 FVYDVTCPASFGSLTSWVEECRQNslg--heVPRYVAPGAQNVgrrrftavvlktrpsesSQVPRGQQERPPPPRrrrLP 188 Tetraodon nigro...
Q14088       115 FVYDVTKMTSFTNLKMWIQECNGHavp--plVPKVLVGNKCDLre--------------qIQVPSNLALKFADAHn-mLL 177 human
Feature 1           ###                             
1Z06_A       162 FETSAKnp--------ndNDHVEAIFMTLAHKLKS 188 house mouse
P91580       158 FETSAKad--------seMGNIEAIFLTVAHKLKS 184 Ciona intestinalis
AAH59345     174 FETSAKr----------tNDHVEAIFMTLVHKLKS 198 African clawed frog
Q20365       244 FETSAKla--------seADHVESIFLTLLHKLQQ 270 Caenorhabditis elegans
AAH75228     159 FETSAKdp--------sqAKNVEKIFMSLACQLKA 185 African clawed frog
AAH36064     175 FETSAKnp--------ndNDHVEAIFMTLAHKLKS 201 human
NP_001008466 173 FETSAKnp--------ndNDHVEAIFMTLAHKLKS 199 chicken
AAI00132     168 FETSAKnpygnedgtqnnSDHVEAIFMTVAHKLKS 202 zebrafish
NP_001007418 178 FETSARdl--------aeKEHVDAIFLTLAYRLKN 204 zebrafish
CAG03706     189 GEPGASpel------rqsPQHDVFPDVCQEPAKKS 217 Tetraodon nigroviridis
Q14088       178 FETSAKdp--------keSQNVESIFMCLACRLKA 204 human

| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap