Conserved Protein Domain Family
alt_F1F0_F1_al

?
TIGR03324: alt_F1F0_F1_al 
alternate F1F0 ATPase, F1 subunit alpha
A small number of taxonomically diverse prokaryotic species, including Methanosarcina barkeri, have what appears to be a second ATP synthase, in addition to the normal F1F0 ATPase in bacteria and A1A0 ATPase in archaea. These enzymes use ion gradients to synthesize ATP, and in principle may run in either direction. This model represents the F1 alpha subunit of this apparent second ATP synthase.
Statistics
?
PSSM-Id: 132367
View PSSM: TIGR03324
Aligned: 6 rows
Threshold Bit Score: 911.841
Threshold Setting Gi: 32398079
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011463473   7 LQKVFDKAFAGMREAREAFAPSLAPREVGTITSIATGIAKVSGLPGVGFDELVKFPGDLFGIAFNVDEAEIGVVLLGEYW 86  Albidiferax fer...
WP_011308026   6 LKDVFDKVFTEIHQARESVTPTLTPKEVGRILTVSTGIANVSGLPTVGFDELIKFPGDLFGIAFNVDEKEIGTVLLGEYS 85  Methanosarcina ...
WP_011575448   9 LKQGYQYLFEHLEQSRQRAQPNLVLQEIGSVKSVSAGIAIVHGLPSAGFEELLRFPGDIYGIAFNIDEHDIGVIMLGDYS 88  Pseudoalteromon...
WP_011342784   8 ATQVLKEAFDTLDSALENFSPVLAVQHVGWVEYIGKGIARVGGLPGVRCEELLAFPGGLLGLALDADEDQVGVVLFGDYT 87  Pelobacter carb...
WP_011357804   6 LTESIDAALSSIGEASRTTQPEIELRENGVVTTVLNGIALIRGLPGVGYEELVEMSGGVYGIAFNVDPDEVGVVLLGEYA 85  Pelodictyon lut...
CAD78174      33 YSETLETAAQQFDQAVKSQPSQLTVTEIGTVEEVQRGIARVHGLPHVQVDEVLRFAGGHLGYAFNLDPDQVGCVLLDSSD 112 Rhodopirellula ...
WP_011463473  87 HLHAGDEVDRTGRVMDVAVGDGLLGRVIDPLGRPLDGRGPVASSHRLPIERPASPIMDRAPVTVPLQTGLKVIDALIPVG 166 Albidiferax fer...
WP_011308026  86 HLHAGDQVERTQRVMDVAVGEELLGRVIDPLGRPLDNKGPIVSSKRLPIERPSPAIMDRAPVTVPLQTGVKVIDALIPIG 165 Methanosarcina ...
WP_011575448  89 QLNAGDEVKRTGRVVDIPVGADLIGRVIDPLGRTLDGKGNLTSTQRMAIERPAPEIMTRSPVTEPLQTGLKVLDALIPIG 168 Pseudoalteromon...
WP_011342784  88 HLQAGDEVRRTGRVLDVPVGDGLIGRVVNPVGRCLDGGKPVAFQRQLPVERPAPPIMDRLPVTQPLMTGIKVIDALIPIG 167 Pelobacter carb...
WP_011357804  86 KLQAGGRARRTGRVMDVPVGDGLLGRVVNPLGRPLDAEGEPRFSGRLPIERPSPGIMDRNAVSTPLQTGLKVVDAIVPIG 165 Pelodictyon lut...
CAD78174     113 QITAGSRVERMHSVLDTPVGDQLLGRVVDPVGRPLDGGRSLDDLPREPCERDAPPIMQRAPVTVPLQSGLKVVDAMIPIG 192 Rhodopirellula ...
WP_011463473 167 RGQRELILGDRQTGKTAIAIDTILNQQGQNVLCVYCAIGQRASAVAKVVATLREKGAMDFTTVVVTEGNDPPGLAYIAPY 246 Albidiferax fer...
WP_011308026 166 RGQRELILGDRQTGKTAIAIDTILNQRNFNVLCVYCAIGQRASAVARAVANLRERGAMDYTIVVVTEGNDPSGLIYIAPY 245 Methanosarcina ...
WP_011575448 169 KGQRELIMGDRQTGKTSIAIDAILNQKDKNVLCVYCAIGQKSASVAKILATLKHHNAFEYTVVMVTEGNDPPGLDYIAPY 248 Pseudoalteromon...
WP_011342784 168 RGQRELILGDRQTGKTAIAIDAIINQRDQDVVCIYCAIGQRAASVAGVVTELRNCGALDYTIVVVAEGDAPPGLQYIAPY 247 Pelobacter carb...
WP_011357804 166 RGQRELILGDRQTGKTAIAVATILNQKGRNVICIYCAIGQRASAVAKVLAQLREHGAMAHTVAVVTEGNDPSGLQYIAPY 245 Pelodictyon lut...
CAD78174     193 RGQRQLLLGDRQTGKTAIAIDTIINQLGRDVICIYCSIGQRSTGVARVIENLRRHDALDHTIVVIGADDAPPGLQFLAPY 272 Rhodopirellula ...
WP_011463473 247 AATSIAEHFMEAGRDVLIVYDDLTQHARAYRELSLLLRRPPGREAFPGDIFYIHSRLLERATHLRQERGGGSLTALPIIE 326 Albidiferax fer...
WP_011308026 246 AATSIAEYFMEAGRDVLIVYDDLTNHARAYRELSLLLRRPPGREAYPGDIFYIHSRLLERSTHLLKELGGGSLTALPIIE 325 Methanosarcina ...
WP_011575448 249 AATSIGEYFMEQGRDVLIVYDDLTQHARSYRELSLLLRRPPGREAFPGDIFYLHSRLLERSTHLNEAHGGGSMTALPIIE 328 Pseudoalteromon...
WP_011342784 248 AATSMAEHFMEHGRDVLIVYDDLTRHARAYREISLLLRRPPGREAFPGDIFYVHSRLLERATHLNEPRGGGSLTALPIIE 327 Pelobacter carb...
WP_011357804 246 AATSIGEYFMEQGRDVLIVYDDLTNHARAYRELSLLLKRPPGREAFPGDIFYVHSRLLERSTHLRKELGGGSLTALPIIE 325 Pelodictyon lut...
CAD78174     273 AATTMGEHFMRQGRDVMIVYDDLTSHARAYRHLSLLLRRPPGREAFPGDIFYVHSRLLERSTHLIQSAGGGSLTALPIIE 352 Rhodopirellula ...
WP_011463473 327 TQAQNISAYIPTNLISITDGQIYLSPSLFELGVLPAVDVGKSVSRVGGKAQRTAYRAVAGDLKLAYAQFEELETFARFGA 406 Albidiferax fer...
WP_011308026 326 TEAQNISAYIPTNLISITDGQIYLSPSLFELGVLPAVDVGKSVSRVGGKAQLAAYRAVAGDIKLAYSQFEELEAFTRFGA 405 Methanosarcina ...
WP_011575448 329 TEEQNMSAYIPTNLISITDGQIYLSPDLFSLGILPAVDVGKSVSRVGGKAQRSAFRKVSGALKLAYAQFEELETFARFGA 408 Pseudoalteromon...
WP_011342784 328 TEAQNLSAYIPTNLISITDGQIYLSPELFQKGLLPSVDVGKSVSRVGGKTQLAAYRAVAGDLRLTYAQFEELEAFARFGT 407 Pelobacter carb...
WP_011357804 326 TEAQNISAYIPTNLISITDGQIYLSPTLFELGNLPAVDIGKSVSRVGGKAQLAAYRSVTGRLKLAYAQFEELENFARFGT 405 Pelodictyon lut...
CAD78174     353 TEAQNVSAYIPTNLISITDGQIYLSPTLFRKGVLPAIDVGRSVSRVGGKTQLPAYRVVAGDLRLTYSQFEELERFARFSS 432 Rhodopirellula ...
WP_011463473 407 RLDENTTKIIEHGRRIRACLKQPESAPVSVAAQIAVLLALSAELFDGVELNQMTEAEQAVRAAAADMPAEVRARFDSADK 486 Albidiferax fer...
WP_011308026 406 RLDENTRKLIEHGRRIRALLKQPQNSPVPVPDQIVILVALNAKLFDNVPLDKMGEAESSLRKAVPDIPADVRDRFKGDKE 485 Methanosarcina ...
WP_011575448 409 RLDANSLQTIEHGQRIRSCLKQAESSPLSVAAQIVILLALTNDLFDAIDLAAMDSAQSAAIDGLTSLPLPIIEKLEQAES 488 Pseudoalteromon...
WP_011342784 408 RLDEETRQVLHRGRRVRAILKQTQSSPRTAPQQVLVLHSLNSGVFDTVDEEALPAAEQAICAAVSEIP-EIVDKILQGKT 486 Pelobacter carb...
WP_011357804 406 RLDEASRKAITHGERIRECLKQDELDVLGVEEQILILLSLSEGQFDPLELSEVSGAMKRLSAAARELPRDLLERLHSDRP 485 Pelodictyon lut...
CAD78174     433 QLDEDTRATLDRGRLIREILKQTQFQPLTLPQQIASLIAVTNGVLDGVPVDQLPTIERAIQDAVTSQANDLCAQMQSGKK 512 Rhodopirellula ...
WP_011463473 487 LSDEDREAIIQIARVAL 503 Albidiferax ferrireducens
WP_011308026 486 LSDKDRETILDIARKSL 502 Methanosarcina barkeri
WP_011575448 489 IEEQDQHIILDMLSQAL 505 Pseudoalteromonas atlantica
WP_011342784 487 LSQEDLDVMHTVAKRVT 503 Pelobacter carbinolicus
WP_011357804 486 LSDEDRRRLLQTAEAAL 502 Pelodictyon luteolum
CAD78174     513 LDKQQVGQIANIAAGAV 529 Rhodopirellula baltica SH 1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap