Conserved Protein Domain Family
phn_thr-fam

?
TIGR03308: phn_thr-fam 
phosphonate metabolism protein, transferase hexapeptide repeat family
This family of proteins contains copies of the Bacterial transferase hexapeptide repeat family (pfam00132) and is only found in operons encoding the phosphonate C-P lyase system (GenProp0232). Many C-P lyase operons, however, lack a homolog of this protein.
Statistics
?
PSSM-Id: 132351
View PSSM: TIGR03308
Aligned: 6 rows
Threshold Bit Score: 346.375
Threshold Setting Gi: 499891089
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011504203  41 VAKMLSVEPTVDPTAQLHEVKLGAYCEVGARTILHEVAMDDYSYVVNDAQITYSTIGKFCSIAAMTRINPGNHPMQRVTQ 120 Rhodopseudomona...
WP_010970705   1 MSVKVGLEPVIHESARVTNSSIGRYTEISERCRLEEVEMGDYSYVMQDGAIWCATIGKFVNIAASVRINATNHPMQRATL 80  Agrobacterium f...
WP_011462471  13 PPASLGLAPTLSASAIVRDCRFGRYTQVGEQTRMGDCLLDDYAYVQHNCDLMSTDIGKFANIANMVRINPGFHPMERPTL 92  Albidiferax fer...
WP_011537310   1 MPKLSASDPYAHPGCSLTNSTFGAWVEIGANTRVANSAFGDYSYCDRMCDIANAQIGKFANIASCVRIGATDHPMEKASL 80  Ruegeria sp. TM...
WP_010910234   6 NLVLKDPEPRIHPTAELKACKLGRYALIGERVVLREVSVGDFSYFERHSEAIYTTIGKFCSIAANSRINALEHPIERLTQ 85  Mesorhizobium loti
WP_011571823  10 RIDSLSPEPTLHDPVHITESNLGRWTDVRSYARVSESTLDDYSYLMERVQLDYTSVGKFVSVASDARLGPTNHPITRPTA 89  Haloquadratum w...
WP_011504203 121 AHFTYRASAYFEGESDDAEFFAWRRAHHVHIGHDVWIGHGAIVLPGRNIGTGAVVAAGAIVTRDVPAYTIVAGNPARLIK 200 Rhodopseudomona...
WP_010970705  81 HHFTYRARSYWDDAEDETDFFAARRAKRVVIGHDVWIGHGATILPGITVGNGAVIGAGAVVSKDVAPYTIVGGVPARLIR 160 Agrobacterium f...
WP_011462471  93 HHFTYRPTMYGMDTQDDADFFAWRLRQRVVIGHDTWIGHGAVIMPGVHIGNGAVVGSNSVVTRDVASYAIVAGAPATVIR 172 Albidiferax fer...
WP_011537310  81 HHFLYRSASYWEDAEDDADWFAHRKSRRAEIGHDTWIGHGALIKPEVTIGHGAVVAAGTVVTKDVAPYTIVGGNTAKLIR 160 Ruegeria sp. TM...
WP_010910234  86 HKVSYRPNEYFRWLGVDAAFRERRQAKAVTIGHDVWIGHGAVIMPGITIGNGAVIGANAVVTQDVPSYTIVAGVPAKPLR 165 Mesorhizobium loti
WP_011571823  90 HHFSYRAAMY-DLGSDDETVFEWRSDHPVTIGHDVWIGHGATILPGVEIGNGAVIAAGSVVTDDVSPYTVVAGVPASVIR 168 Haloquadratum w...
WP_011504203 201 RRFPEFVANRLADLTWWDWDHEALRKALPDFRRLPVEEFLDKYE 244 Rhodopseudomonas palustris
WP_010970705 161 ERFPAELGKRMDDLNWWDWDHARLRSALEDFRALDAEDFVAKYG 204 Agrobacterium fabrum
WP_011462471 173 QRFPRAIAQALEATAWWDWDHDTLTERMPDFKDMRC--FLAKYA 214 Albidiferax ferrireducens
WP_011537310 161 RRYTEPVAERMIALAWWDWDHATLRAALADFRALPAEAFLEKYE 204 Ruegeria sp. TM1040
WP_010910234 166 PRFAPDIAARIEALAWWDWPVEKLARAVPDIQSMPIEAFLDRWE 209 Mesorhizobium loti
WP_011571823 169 RRFAPEIAARIESTEWWHWSHETLSERIAAFRDL--EMFLDMYA 210 Haloquadratum walsbyi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap