Conserved Protein Domain Family

TIGR03308: phn_thr-fam 
phosphonate metabolism protein, transferase hexapeptide repeat family
This family of proteins contains copies of the Bacterial transferase hexapeptide repeat family (pfam00132) and is only found in operons encoding the phosphonate C-P lyase system (GenProp0232). Many C-P lyase operons, however, lack a homolog of this protein.
PSSM-Id: 132351
Aligned: 6 rows
Threshold Bit Score: 346.375
Threshold Setting Gi: 499891089
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
WP_011462471 173 QRFPRAIAQALEATAWWDWDHDTLTERMPDFKDMRC--FLAKYA 214 Albidiferax ferrireducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap