2WSC


Conserved Protein Domain Family
PS_I_psaG_plant

?
TIGR03051: PS_I_psaG_plant 
Click on image for an interactive view with Cn3D
photosystem I reaction center subunit V, chloroplast
Statistics
?
PSSM-Id: 132095
View PSSM: TIGR03051
Aligned: 7 rows
Threshold Bit Score: 122.239
Threshold Setting Gi: 131191
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2WSC_G    76 VISLSTGLSLFLGRFVFFNFQRENMAKQ-VPEQNGMSHFEAGDTRAKEYVSLLKSNDP---VGFNIVDVLAWGSIGHIVA 151 spinach
P12357    76 VISLSTGLSLFLGRFVFFNFQRENMAKQ-VPEQNGMSHFEAGDTRAKEYVSLLKSNDP---VGFNIVDVLAWGSIGHIVA 151 spinach
Q9S7N7    67 VISLSTGLSLFLGRFVFFNFQRENVAKQgLPEQNGKTHFEAGDDRAKEYVSLLKSNDP---IGFNIVDVLAWGSIGHIVA 143 thale cress
Q00327    51 VISLSTGLSLVMGRFVFFNFQRENVAKQ-VPEQNGKTHFEAGDERAKEFAGILKSNDP---VGFNLVDVLAWGSIGHIVA 126 Hordeum vulgare
Q9SPM4    21 IISASTAALLALGRFVFLPFQRSMVSRHgLPEQNGVPTTRRVTAVRRRWWSMLKTNDP---AGFTLVDVLAWGALGHAVG 97  Syntrichia ruralis
P14224    37 VISGSTAAFLAIGRFVFLGYQRREANFDs---TVGPKTTGATYFDDLQKNSTIFATNDp--AGFNIIDVAGWGALG--HA 109 Chlamydomonas reinh...
AAK08496  33 AIGGSTVSFLALGRFVFLPYQRRRTEMEvGPGRLGPKTTGDTFFDRLQEACFLRGDQDkgpSGFGLIDVIGWGALATRRL 112 Dunaliella salina
2WSC_G   152 Y-YILATAS-----NGYD 163 spinach
P12357   152 Y-YILATAS-----NGYD 163 spinach
Q9S7N7   144 Y-YILATSS-----NGYD 155 thale cress
Q00327   127 Y-YILATTS-----NGYD 138 Hordeum vulgare
Q9SPM4    98 F-FILATAT-----NGYN 109 Syntrichia ruralis
P14224   110 VgFAVLAINs---lQGAN 124 Chlamydomonas reinhardtii
AAK08496 113 VlFFFLPENqviahWGVR 130 Dunaliella salina
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap