Conserved Protein Domain Family
adh_III_F_hyde

?
TIGR02818: adh_III_F_hyde 
S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
The members of this protein family show dual function. First, they remove formaldehyde, a toxic metabolite, by acting as S-(hydroxymethyl)glutathione dehydrogenase (1.1.1.284). S-(hydroxymethyl)glutathione can form spontaneously from formaldehyde and glutathione, and so this enzyme previously was designated glutathione-dependent formaldehyde dehydrogenase. These same proteins are also designated alcohol dehydrogenase (EC 1.1.1.1) of class III, for activities that do not require glutathione; they tend to show poor activity for ethanol among their various substrate alcohols. [Cellular processes, Detoxification, Energy metabolism, Fermentation]
Statistics
?
PSSM-Id: 131865
View PSSM: TIGR02818
Aligned: 5 rows
Threshold Bit Score: 696.193
Threshold Setting Gi: 1168354
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAD79249       2 KSRAAIAWAAGQPLTIEEVDVQAPQAGEVMVKLVATGVCHTDAFTLSGADPEGIFPCILGHEGAGIVVEVGEGVTSVAVG 81  Synechococcus e...
CAE78841       2 KIKAAVAWKAGAPLSIEEVDLEGPKKGEVLIRVVATGVCHTDAFTLSGADPEGLFPVILGHEGGGIVEEVGEGVTTLKKG 81  Bdellovibrio ba...
vfiat:VF0648  13 KSKAMVAWAAGEPLKMEEVDVQLPKAGEVLVRIVATGVCHTDLFTLSGDDPEGIFPSILGHEGGGIVEMVGEGVTGLEVG 92  Vibrio fischeri...
AAN57900       5 KTRAAVAWAPNEPLKIEELDLMMPQKGEVMVHITATGVCHTDAYTLSGKDAEGVFPCVLGHEGAGIVEAVGEGVTEFQVG 84  Streptococcus m...
P44557        11 KSRAAVAFAPNQPLQIVEIDVEMPRKGEVLIRNTHTGVCHTDAFTLSGSDPEGVFPVVLGHEGAGVVVAVGEGVLSVKPG 90  Haemophilus inf...
BAD79249      82 DHVIPLYTPECGECKFCKSGKTNLCQAIRATQGKGLMPDGTSRFSLNGQPIYHFMGTSTFSEYTVLPEIAIAKINPAAAL 161 Synechococcus e...
CAE78841      82 DHVIPLYTPECKECKFCLSGKTNLCVRIRATQGKGLMPDGTSRFSKDGKMIHHYMGCSTFAEYTVVPEIALAKVNPAAPL 161 Bdellovibrio ba...
vfiat:VF0648  93 DHVIPLYTAECGECKFCKSGKTNLCQAVRETQGQGLMPDGTSRFSINGETIFHYMGCSTFSEYTVLPEISLAKVSKDAPL 172 Vibrio fischeri...
AAN57900      85 DHVIPLYTAECGKCEFCLSGKTNLCSAVRETQGRGVMPDGTVRFFKDGQPIYHYMGTSTFAEHTVVSEYSLVKIQDNAPL 164 Streptococcus m...
P44557        91 DHVIPLYTAECGECEFCRSGKTNLCVSVRDTQGKGLMPDCTTRFSYQGQPIYHYMGCSTFSEYSVVAEVSLAKINPEANH 170 Haemophilus inf...
BAD79249     162 DKVCLLGCGITTGIGAVLNTAKVEPGSTVAVFGLGGVGLSVIQGAVLAKASRILAIDINPDKAEFAKQLGATDFINPKDY 241 Synechococcus e...
CAE78841     162 DKVCLLGCGVTTGIGAVLNTAKVEKGATVAVFGLGGIGLSVIQGAKMAGASRIIAIDINDAKWEMAQKFGATDFVNPKKH 241 Bdellovibrio ba...
vfiat:VF0648 173 EEVCLLGCGVTTGMGAVLNTAKVEKGDTVAVFGLGGIGLSAIIGAKMAGASRIIGVDLNESKYELAKKLGATDCINPMNY 252 Vibrio fischeri...
AAN57900     165 EEVCLLGCGVTTGMGAVLNTAKVEEGATVAIFGLGGIGLAAIIGARMAKASRIIAIDINPDKFDKARKLGATDLVNPNNH 244 Streptococcus m...
P44557       171 EQVCLLGCGVTTGIGAVHNTAKVQEGDSVAVFGLGAIGLAVVQGARQAKAGRIIAIDTNPAKFELAKQFGATDCLNPNDY 250 Haemophilus inf...
BAD79249     242 DRPIQEVIVELTDGGVDYSFEAIGNVNTMRAALESCHKGWGESTIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRS 321 Synechococcus e...
CAE78841     242 DKPIQQVIVEMTEWGVDYSFECVGNTQLMRAALECAHRGWGQSIVIGVAGAGQEISTRPFQLVTGRVWKGSAFGGVKGRT 321 Bdellovibrio ba...
vfiat:VF0648 253 DKPIQEVIVEMTDGGVDYSFECIGNVNVMRSALECCHKGWGESIIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVKGRT 332 Vibrio fischeri...
AAN57900     245 AKPIQEVIIDITNGGVDYSFECIGNVEVMRAALECCHKGWGESTIIGVAPAGAEIHTRPFQLVTGRVWRGSAFGGVKGKT 324 Streptococcus m...
P44557       251 DKPIKDVLLDINKWGIDHTFECIGNVNVMRQALESAHRGWGQSIIIGVAGAGQEISTRPFQLVTGRVWKGSAFGGVKGRS 330 Haemophilus inf...
BAD79249     322 QLPGYVEQYLNGQIKVDEFVTETRPLEEINEAFEDMHAGKVIRTVITF 369 Synechococcus elongatus PCC 6301
CAE78841     322 ELPGYVEQYMSGEINIDDMVTFTMPLEDINKAFDYMHEGKSIRSVIKM 369 Bdellovibrio bacteriovorus HD100
vfiat:VF0648 333 ELPGIVDRYMQGEFALDDFITHTMGLADVNAAFDLMHEGKSIRTVLHM 380 Vibrio fischeri ES114
AAN57900     325 QLPGIVGQYMAGEFALSDFITHTMPLEQINDAFDLMHEGKSIRTVIHY 372 Streptococcus mutans UA159
P44557       331 ELPQMVEDSMKGDIQLEPFVTHTMPLDKINEAFELMHEGKSIRTVIHY 378 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap