Conserved Protein Domain Family
Lon_rel_chp

?
TIGR02653: Lon_rel_chp 
conserved hypothetical protein
This model describes a protein family of unknown function, about 690 residues in length, in which some members show C-terminal sequence similarity to pfam05362, which is the Lon protease C-terminal proteolytic domain, from MEROPS family S16. However, the annotated catalytic sites of E. coli Lon protease are not conserved in members of this family. Members have a motif GP[RK][GS]TGKS, similar to the ATP-binding P-loop motif GxxGxGK[ST]. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131701
View PSSM: TIGR02653
Aligned: 4 rows
Threshold Bit Score: 1219.7
Threshold Setting Gi: 39984093
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAL59723  18 SADLDALLNQYFKGRVVRKDLTKQLKEGANVPVYVLEYLLGMYCASDDDEVVMQGLDNVKKILAENYVRPDEAEKVKSLI 97  Vibrio cholerae
AAL23309  21 GYDLDALLNQHFRGRVVRKDLTKQLKEGANVPVYVLEYLLGMYCASDDDQIVEQGLQNVKRILADNYVRPDEAEKVKSLI 100 Salmonella enterica...
AAM29860  10 SLETDRKLIQHFPGRVVRKDLTKLLKVGHNVPVYVLEYLLGSYCADDDEEVIQEGIQIVKNILSQNYVRPDEAEKIKSRI 89  Methanosarcina maze...
AAR35481   2 NDVLDQKLVDVFSGKVVRKDLVRKVKVGANVPVFVLEYLLGKYCATDDEAAMEAGLRVVNNTLAENFVRPEEANKAQALV 81  Geobacter sulfurred...
AAL59723  98 RERGTFKIIDKVSVKLNQKKDVYEAALSNLGIKDALVPTKIVQDNEKLLTGGIWCIITVQYFFEEGQ--KTSPFSIMSLK 175 Vibrio cholerae
AAL23309 101 RERGSYKIIDKVSVKLNQKKDVYEAQLSNLGIKDALVPPQMVKDNEKLLTGGIWCMITVNYFFEEGQ--KTSPFSLMTLK 178 Salmonella enterica...
AAM29860  90 RETGYYTVIDKITVILNERRDIYEAEFSNLGLKNIEIDSDYVIKYDKLLGGGIWCMIKMEYSTES----ASSPFIISSLK 165 Methanosarcina maze...
AAR35481  82 REKGRHTFIDKVKVRYLAEDDKYWAECVNFGHKYLHIPERYIREYDRLLMGGVWAQMEIRHQYDEEAkgRRSPFWIESIT 161 Geobacter sulfurred...
AAL59723 176 PIQMPSMNMDEVFSTRRHFSTDQWMDVLLRSVGMEPTNLEHRVKWHLITRMIPFVENNYNVCELGPRGTGKSHVYKECSP 255 Vibrio cholerae
AAL23309 179 PIQMPNMDMEEVFTARTHFNRDQWIDVLLRSVGMEPANIEQRTKWHLITRMIPFVENNYNVCELGPRGTGKSHVYKECSP 258 Salmonella enterica...
AAM29860 166 PIQIPNVNIQEILAERKNFTKDEWIDVLMRSIGMEPTQLETSTKWHMLERLVPLVENNYNLCELGPKSTGKSHVYKEISP 245 Methanosarcina maze...
AAR35481 162 PIQLATFDLNAYQEGRRQFTSEEWVDMLIRSVGMEPEHFTRRLKLLFLIRLIPLCEANYNLVELGPRGTGKSYAYQELSP 241 Geobacter sulfurred...
AAL59723 256 NSLLVSGGQTTVANLFYNMSSRQVGLVGMWDVVAFDEVAGINFKDKDGVQIMKDYMASGSFARGRDSIEAKASMVFVGNI 335 Vibrio cholerae
AAL23309 259 NSLLVSGGQTTVANLFYNMASRQIGLVGMWDVVAFDEVAGITFKDKDGVQIMKDYMASGSFSRGRDSIEGKASMVFVGNI 338 Salmonella enterica...
AAM29860 246 NTILMSGGQTTVANLFYNMGTRQIGLVGFWDVVAFDEVAGIRFKDKDGIQILKDYMASGSFARGKEQKNANASIVFVGNV 325 Methanosarcina maze...
AAR35481 242 YAILMTG-PTTVANLFFNISTNKMGLVGLWDAVAFDEVADLEKMPKEVVTTMKTYCESGSFARGKESLSGMASIALFGNT 320 Geobacter sulfurred...
AAL59723 336 NQTVETLVKTSHLLAPFPDAM-IDTAFFDRFHSYIPGWEIPKMRPEYFTNSYGLITDYLAEYMREMRKRSFADAIDKFFK 414 Vibrio cholerae
AAL23309 339 NQSVETLVKTSHLLAPFPAAM-IDTAFFDRFHAYIPGWEIPKMRPEFFTNRYGLITDYLAEYMREMRKRSFSDAIDKFYK 417 Salmonella enterica...
AAM29860 326 NQSIESLLKTSHLFSPFPEAMnSDTAFFDRMHYYLPGWEIPKFRPEHFTDRYGFIVDYIAEFFREMRKRSYADNINRFFK 405 Methanosarcina maze...
AAR35481 321 NQPVETMVKSSHLFIPLPEIVrEDMAFLDRIHYYIPGWEIPKMRIEYFTQHYGFVVDYLAEALRELRRHNFTEVSDRYFS 400 Geobacter sulfurred...
AAL59723 415 LGNNLNQRDVIAVRRTVSGLLKLLHPDAQYTKDDVRACLTYALETRRRVKEQLKKLGGMEFFDVHFSYIDNDSLEEFFVN 494 Vibrio cholerae
AAL23309 418 LGNNLNQRDVIAVRRTVSGLLKLLHPNGSYSKEDVRVCLTYAMEARRRVKEQLKKLGGLEFFDVNFSYIDNETLEEFFVS 497 Salmonella enterica...
AAM29860 406 LGNNLNQRDVIAVKKTFSGLMKLIYPDENITREQAQEILEYTLVGRRRVKEQLKKIGGIEFFDVNFSYIDNENLKESFVS 485 Methanosarcina maze...
AAR35481 401 FGAHLNARDVKAVRKTVSGLVKLLYPHGEFTKDELAETVDIAMEGRRRVKEQLKKMGSFEYHQTSFSYRDNESTEERYIG 480 Geobacter sulfurred...
AAL59723 495 VPEQGGSKLIPEGLPRAGVVHLVTQGSTGQLGLYRFETQMMAGSGKHSVSGLGSNTAAKEAVRVGFDYFKGNLNRISASA 574 Vibrio cholerae
AAL23309 498 VPEQGGSELIPAGMPKPGVVHLVTQAESGMTGLYRFETQMTAGNGKHSVSGLGSSTSAKEAIRVGFDYFKGNLSRVSATA 577 Salmonella enterica...
AAM29860 486 VPESGGNKIIPAGITKPGEAYAVGATESGKIGIYKFEVQVVAGSGKYEKSGTGSNTQTKESIKTAFNYFKANAKSISQSI 565 Methanosarcina maze...
AAR35481 481 VPEEGGRALISTDPLAPGSVYAASVNADGKVGLYRIEVGVSAGTGKLKLAG-GVESTMKESITRAFGFLQGHKVPMGIAS 559 Geobacter sulfurred...
AAL59723 575 KFSDHEYHLHVVELHNTGPSTKSSLAALIAFCSILMNRPIQEQMVVLGEMTLGGVVNPVQDLAGSLQLAMDSGAKRILLP 654 Vibrio cholerae
AAL23309 578 KFSEHEYHLHVVELHNTGPSTATSLAALIALCSVLLAKPVQEQMVVLGSMTLGGVINPVQDLAASLQLAFDSGAKKVLLP 657 Salmonella enterica...
AAM29860 566 SVKEKDYFLHVQDLYGVGMSEELALPAFISLCSGALERSLQEQTAILGSMTIGGSVGILENLAGLLQVCLDAGAKRVMIP 645 Methanosarcina maze...
AAR35481 560 IFDTTDFHVEAIDLLTNRVGCEAGIAFIIAIISAIKKTQVAPGMVILGDLSIQGNIKGVSSLSEPLQIAMENGAKRALIP 639 Geobacter sulfurred...
AAL59723 655 MASASDIPTVPAELFSKFQISFYADPVDAVFKALGVN 691 Vibrio cholerae
AAL23309 658 MSSAVDIPTVPAELFTKFQVSFYSEPVDAVYKALGVN 694 Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
AAM29860 646 ISSAGKIATVPPDLFSKFQISFYEDPIDAVYKSMSLI 682 Methanosarcina mazei Go1
AAR35481 640 LENKRNFLEVSGEIVEKVDPVFFSDPQTAAAKALNLS 676 Geobacter sulfurreducens PCA
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap