1ECR


Conserved Protein Domain Family
rep_term_tus

?
TIGR02648: rep_term_tus 
Click on image for an interactive view with Cn3D
DNA replication terminus site-binding protein
Members of this protein family are found on the main chromosomes of a number of the Gammaproteobacteria; this model excludes related plasmid proteins, which score between trusted and noise cutoffs. This protein, DNA replication terminus site-binding protein, binds specific DNA sites near the replication terminus to arrest the DNA replication fork. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 131696
View PSSM: TIGR02648
Aligned: 5 rows
Threshold Bit Score: 524.391
Threshold Setting Gi: 2554909
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ECR_A    10 LNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSK 89  Escherichia coli BW...
CAE14649  10 LNSCFQQQESKLKQLYEQLNSYSLLAAHVFILPDVEKGCEHEPVTEIIVNEMTGNDARNIGLSHYQKLFIYHNNQNISSK 89  Photorhabdus lumine...
CAG75164  10 MNDCFQTLEIKLAVMQQQFSTYRLLAGRVYSLPPVEKGTEHDPIEHIAVTQYVGQEARDKGLAHFQRLFIHHYPEALSSK 89  Pectobacterium atro...
P16525    10 LNTTFRQMEQELAIFAAHLEQHKLLVARVFSLPEVKKEDEHNPLNRIEVKQHLGNDAQSLALRHFRHLFIQQQSENRSSK 89  Escherichia coli K-12
AAS62275  23 MNTRFAELEVTLHQLHQQLDDLPLIAARVFSLPEIEKGTEHQPIEQITVNITEGEHAKKLGLQHFQRLFLHHQGQHVSSK 102 Yersinia pestis bio...
1ECR_A    90 AAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLR 169 Escherichia coli BW...
CAE14649  90 AAVRLPGVLCFSVNQQQYRSALLLIEEINKLKAELEHIVTVQSGVDKEQRFEFVHSQLHGLITLNAYRTITPLLNPDSVR 169 Photorhabdus lumine...
CAG75164  90 SAIRLPGALCFAVNAAQYQQAHTLIAEINALKKELEQIITVESGLEPEQRFEFVHSHLKGLITLSAYRSLTLITNPASVR 169 Pectobacterium atro...
P16525    90 AAVRLPGVLCYQVDNLSQAALVSHIQHINKLKTTFEHIVTVESELPTAARFEWVHRHLPGLITLNAYRTLTVLHDPATLR 169 Escherichia coli K-12
AAS62275 103 AALRLPGVLCFSVTDKELIECQDIIKKTNQLKAELEHIITVESGLPSEQRFEFVHTHLHGLITLNTYRTITPLINPSSVR 182 Yersinia pestis bio...
1ECR_A   170 FGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQK 249 Escherichia coli BW...
CAE14649 170 FGWANKNIINKVTKDQILQRLEKSYNSGRAVSPYSREQWAALVAKEIIDIKKLPDDVVLKIKRPVKVQPIARVWYAEQQK 249 Photorhabdus lumine...
CAG75164 170 FGWANKHVINNMTRIALLEKLTKSLNAAKHAASYTKAQWIEHVEQEMDAVLQLPEDAVLKIKRPVKVQPIARVWYAEQQK 249 Pectobacterium atro...
P16525   170 FGWANKHIIKNLHRDEVLAQLEKSLKSPRSVAPWTREEWQRKLEREYQDIAALPQNAKLKIKRPVKVQPIARVWYKGDQK 249 Escherichia coli K-12
AAS62275 183 FGWANKHIIKNVTREDILLQLEKSLNAGRAVPPFTREQWRELISLEINDVQRLPEKTRLKIKRPVKVQPIARVWYQEQQK 262 Yersinia pestis bio...
1ECR_A   250 QVQHACPTPLIALINRdNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD 309 Escherichia coli BW2952
CAE14649 250 QVQYACPLPIIAFYVN-YGDNQPKIGRLANYDANAIVHRYKPKAKPLELIIPRLHLYREI 308 Photorhabdus luminescens subsp. laumond...
CAG75164 250 QVQHPCPSPLLVLCQQeSGGTMPIIGELNPYDAHNIKHKHKPKAAELRLLIPRLHLYTDA 309 Pectobacterium atrosepticum SCRI1043
P16525   250 QVQHACPTPLIALINRdNGAGVPDVGELLNYDADNVQHRYKPQAQPLRLIIPRLHLYVAD 309 Escherichia coli K-12
AAS62275 263 QVQHPCPMPLIAFCQHqLGAELPKLGELTDYDVKHIKHKYKPDAKPLRLLVPRLHLYVEL 322 Yersinia pestis biovar Microtus str. 91001
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap