Conserved Protein Domain Family
mob_myst_B

?
TIGR02613: mob_myst_B 
mobile mystery protein B
Members of this protein family, which we designate mobile mystery protein B, are found in mobization-related contexts more often than not, including within a CRISPR-associated gene region in Geobacter sulfurreducens PCA, and on plasmids in Agrobacterium tumefaciens and Coxiella burnetii, always together with mobile mystery protein A (TIGR02612), a member of the family of helix-turn-helix DNA binding proteins (pfam01381). This protein is encoded by the downstream member of the gene pair and belongs to the Fic protein family (pfam02661), where Fic (filamentation induced by cAMP) is a regulator of cell division. The characteristics of having a two-gene operon in a varied context and often on plasmids, with one member affecting cell division and the other able to bind DNA, suggests similarity to addiction modules.
Statistics
?
PSSM-Id: 131662
View PSSM: TIGR02613
Aligned: 4 rows
Threshold Bit Score: 311.769
Threshold Setting Gi: 14022680
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAR34767       9 ATPLDSDEAEGLLLTHITSRGELDRWEQENIAEGEAWAFGRRQK---NILSEAFIRRLHKRMFGHVWRWAGEFRRSDKNI 85  Geobacter sulfu...
BAB49289      10 ATPLDPNELAGLKHRHITTQAELDELEQANITSGLLWLSRTRRK---DILSDGFAIELHRQLFGQVWNWAGAFRTTGKNI 86  Mesorhizobium l...
CAE79576       9 ATPLDDETLRGLIPG-LTTHGELDEFEAANIARAILWAESSRSLk-kDLLSLTGLKRLHQKMFEDTWRWAGDLRTRQTNI 86  Bdellovibrio ba...
WP_010974878  11 ATPLEPQEREGLLQSWITHRQDLNEAEQENIVEGAAWARGRRRMpvgRMLTEDFMRTLHRRMFGEVWQWAGSFRTTERNI 90  Agrobacterium f...
AAR34767      86 GVTWWQVPIELRKLCDDVVAWIAFGTYPPDEIAVRFHHRLVAIHPFANGNGRHARTMTDLLLVQALqRPRFTWGSG-NLV 164 Geobacter sulfu...
BAB49289      87 GVDPAQIGSQLRVVLDDARYWADKGTYMPREAAVRLHHRIVFVHPFANGNGRHARILADAVLEKIYkVDPIDWTAGsDLQ 166 Mesorhizobium l...
CAE79576      87 GVSPLSIQSDMAILLGDISYWLQNQTFSVEEIAIRFHHRLVYIHPFPNGNGRCARLATDLFLKQQG-YSGFTWGRA-SLA 164 Bdellovibrio ba...
WP_010974878  91 GIQAYRIPVELAALLDDVRYWVQHETFAADEIAIRFHHRLVAIHPFPNGNGRHARLAADLLVEKLG-AEPFSWGSG-SLG 168 Agrobacterium f...
AAR34767     165 SVGDCRRYYIEALRAADRH-DYQLLLEFVR 193 Geobacter sulfurreducens PCA
BAB49289     167 KMNERRAGYIAALKAADRH-DITPLLAFVG 195 Mesorhizobium loti MAFF303099
CAE79576     165 LAGHLRKEYIRCLKLADKAgEYGPLLNFAK 194 Bdellovibrio bacteriovorus HD100
WP_010974878 169 DVGDLRTRYVAALQAADNH-DIAPLLEFAR 197 Agrobacterium fabrum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap