Conserved Protein Domain Family
sucr_syn_bact_C

?
TIGR02471: sucr_syn_bact_C 
sucrose-phosphate synthase, sucrose phosphatase-like domain, bacterial
Sucrose phosphate synthase (SPS) and sucrose phosphate phosphatase (SPP) are the last two enzymes of sucrose biosynthesis. In cyanobacteria and plants, the C-terminal region of most or all versions of SPS has a domain homologous to the known SPP. This domain may serve a binding or regulatory rather than catalytic function. Sequences in this family are bacterial C-terminal regions found in all but two of the putative bacterial sucrose phosphate synthases described by TIGR02472.
Statistics
?
PSSM-Id: 131524
View PSSM: TIGR02471
Aligned: 4 rows
Threshold Bit Score: 370.251
Threshold Setting Gi: 16605569
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAC87822     467 LLLLDLDSSLEEpEAEGLASLREGLEsiGSGDAHGLGVLTGRSVQAAKKRYAELNLPSPRVWISRAGTEIHYGLEDQSDR 546 Prochlorococcus...
CAD85124     476 VIISDIDNTLLG-DEQGLAEFLQWLR--MHAGNISFGIATGRTVESAVRILKKWRVPMPDILITSVGSEINYWPSLRPDK 552 Nitrosomonas eu...
CAD78343     480 IIMTDLDNTLTG-DDEALADFVDLLN--TAGRDVGFGIDTGRSLDEAMSLITKLNLPRPDVLSAAVGTELYYGEGLTPDL 556 Rhodopirellula ...
WP_011715057 471 AIITDLDQNLLG-DDTSLSAFVALMR--QYRKQVSFGIATGRNLESALSVMRKHKIPQPDVIMANLGTEVYYAPDLLLDS 547 Magnetococcus m...
CAC87822     547 FWQAHIDVDWRRQAVVSALADLKDhLTLQDDQEQGPHKVSYLLKEHGEAILPLVRQRLRQRSQAARPHLRCHWFLDVVPL 626 Prochlorococcus...
CAD85124     553 GWSNHIRHRWRREALAEALKEIPG-LALQAPENQREFKLSYLVTPERMPPLKQLYQHLHKQNLHAKLIYSHEAFLDVLPV 631 Nitrosomonas eu...
CAD78343     557 SWRKQIKHHWQPKLVHEVLDSIPG-LFLQTEKDQTEFKISYRIDPEDSPSVAQIRKMLRSAGLRVKVVLSLGSFLDIIPL 635 Rhodopirellula ...
WP_011715057 548 AWKKHINHLWFRHEIVEILSQVPG-LSMQPKGSQSPFKISYYMDPNVAPDLQEINRILHQQEQTVNVIFSRGQFLDILPH 626 Magnetococcus m...
CAC87822     627 RASRSEAIRYLSLRWGLPLEQILVVASQQGDAELVRGLTASVVLAE-HDPCLEGLRHQQRVFFANNPHLFGLLDGLNHYR 705 Prochlorococcus...
CAD85124     632 RASKGLAVRYLAYKWGLPLQSFLIAGDSGNDEEMLVGDTLGVVVGN-HSPELESLRDREQIYFAKNTYALGILEGMKHYH 710 Nitrosomonas eu...
CAD78343     636 RGGSELSLRHLAYRWGFEPERLLVAGDCGNDEGMLKGGTLGVVVGN-YSPELEKLRRLPRIYFAEGNHARGIMEGIEYYD 714 Rhodopirellula ...
WP_011715057 627 RASKGYALRWVSAQLDIPLENMLVAGGSGADEDMMRGNTQAVVVGNrHDEELSTLAEVDKIYFAQQSYAAGIIEAIDHYD 706 Magnetococcus m...
CAC87822     706 F 706 Prochlorococcus marinus
CAD85124     711 F 711 Nitrosomonas europaea ATCC 19718
CAD78343     715 F 715 Rhodopirellula baltica SH 1
WP_011715057 707 F 707 Magnetococcus marinus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap