Conserved Protein Domain Family
TIGR02452

?
TIGR02452: TIGR02452 
TIGR02452 family protein
Members of this uncharacterized protein family are found in Streptomyces, Nostoc sp. PCC 7120, Clostridium acetobutylicum, Lactobacillus johnsonii NCC 533, Deinococcus radiodurans, and Pirellula sp. for a broad but sparse phylogenetic distibution that at least suggests lateral gene transfer.
Statistics
?
PSSM-Id: 131505
View PSSM: TIGR02452
Aligned: 5 rows
Threshold Bit Score: 367.631
Threshold Setting Gi: 499475788
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAD76352       5 QLAQEVLDLIDAGEYRVDET-VVRFAEQQNRAVQSTRLYRPD-----ELESLRAEPAKVRQVVHVVDGTTQVVAQQLS-- 76  Rhodopirellula ...
WP_010995544   5 AIAENTLKILNIGNYICADGnQVYISQELEYCLYLTKCYSPEnlakiETKVLNSLPRFSATEFAVRNETTLIGAERIVks 84  Nostoc sp. PCC ...
WP_003977949  57 GIAQQTEQIVAAGSYRTSDGrEVPLAAAVGAARDGTRMYGPG-------PVEVTVPAGARTAFEVTGESSLEAARRLG-- 127 Streptomyces li...
WP_010965841  10 NIASETLSVINDGYYINKSNeKIDIKTFTDRAIEGTELVCELk----NEEGNKLNASLDKAELTVVNNATINAIIELRns 85  Clostridium ace...
WP_011162428   6 TVMANQHNILMKEKYSDDTT----------LSIQQSKIYDGQ--------DAFLYTNHHYSKLKFVNLSSAHAAVDLKek 67  Lactobacillus j...
CAD76352      77 -GAGELALLNFASARNPGGGFLNGAKAQEEDLCRCSGLYPCLIE-HMEYYEA-NRNQSSLLYTDHAIFSPKVPFFRTrGT 153 Rhodopirellula ...
WP_010995544  85 eKFQQVGVLNFASAKNPGGGFIRGAQAQEESLARSSALYKSLLK-CPEYYNF-HRHERSLLYSDWMIYSPSCPVFKN-DD 161 Nostoc sp. PCC ...
WP_003977949 128 ---GDVAVLNFASARNPGGGYLNGAQAQEEALCRASALYTCLLR-AREFYDH-HRAHRDPFYTDRVVHSPGVPVFRD-DR 201 Streptomyces li...
WP_010965841  86 gISGNVIALNFASAKNPGGGFQSGANAQEESIARASSIYPCLIKyKEEFYEF-HKEQKNPLYSDKMIYSKDVPIFRD-DS 163 Clostridium ace...
WP_011162428  68 yFACKIALLNFADYLSPGGRYLQGATAQEEILCHQSNLYQIISN-FNKYYEWnNQHINYHLYRNRAIYSPNV-VFTN-LD 144 Lactobacillus j...
CAD76352     154 GDLLEVPFFASVITVPAPNSRPFLRGNPNATEELESTFLRRWRNVLRIARDQNVKCLLLGAWGCGAFGGDPLMASRTAKS 233 Rhodopirellula ...
WP_010995544 162 GELLAQPYVVDFITSPAPNAGMIQKNQPHLSVKIPQVLMNRTSKLLSLASNQGCDALVLGAWGCGVFRNDPAIVSQIFAD 241 Nostoc sp. PCC ...
WP_003977949 202 GRLLDEPFTAGFLTSAAPNAGVVLRTAPERAAGLPAALTGRAERVLETAAAHGYRRLVLGAWGCGVFRNDPAQVAGAFRT 281 Streptomyces li...
WP_010965841 164 GDFLSEPILCSFITSPAVNAR-VARERGINESEIREAMNIRIKKIIKLTLSKNPKAIVLGAFGCGVFGNNPADVAKIFCQ 242 Clostridium ace...
WP_011162428 145 GTLINT---INVITCAAPYYR-EAQLYNISYEEACMTLKNRMYFVKNIAEDQQIDYLVLGAWGAGAFGFSSKEVAKMWHD 220 Lactobacillus j...
CAD76352     234 AIASDG---GDISEIVFAIPGTGRQsKANLDAFRE 265 Rhodopirellula baltica SH 1
WP_010995544 242 LLLPGGqfwGRFKSVIFSVLDNSKQ-QAIFTEFDR 275 Nostoc sp. PCC 7120
WP_003977949 282 LLGPGGrfaGAFERVAFGILDRTPG-ATVRAAFER 315 Streptomyces lividans
WP_010965841 243 QLK-ENiskLRDIKIVFAIYDRN---MTIVNIFRK 273 Clostridium acetobutylicum
WP_011162428 221 VFS-HP---SSIKEVDFAVIDIHG--SNNTQIFKS 249 Lactobacillus johnsonii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap