2IA2


Conserved Protein Domain Family
pcaR_pcaU

?
TIGR02431: pcaR_pcaU 
Click on image for an interactive view with Cn3D
beta-ketoadipate pathway transcriptional regulators, PcaR/PcaU/PobR family
Member of this family are IclR-type transcriptional regulators with similar DNA binding sites, able to bind at least three different metabolites related to protocatechuate metabolism. Beta-ketoadipate is the inducer for PcaR, p-hydroxybenzoate for PobR, and protocatechuate for PcaU. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 131484
View PSSM: TIGR02431
Aligned: 16 rows
Threshold Bit Score: 336.925
Threshold Setting Gi: 29607355
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IA2_A        13 SPDYVQSLARGLAVIRCFDHRNQRRTLSDVARATDLTRATARRFLLTLVELGYVATDGSAFWLTPRVLELGYSYLSSLSL 92  Rhodococcus jos...
O83046        27 HEDFVAGISKGMAILDSFGTDRHRLNITMAAEKTGMTRAAARRHLLTLEYLGYLESDGHYFYLTPKILKFSGSYLGGAQL 106 Acinetobacter s...
AAN68217       8 PRDLIAGLQKGLALMQLFSAEQPRLSVPQAARLSGLTSSAVRRFLLTLVHEGFAETDSRDYWLTPKALRIGQAYVDSAQL 87  Pseudomonas put...
Q52154        41 DPDFMTSLARGLAVIQAFQERKRHLTIAQISHRTEIPRAAVRRCLHTLIKLGYATSDGRTYSLLPKVLTLGHAYLSSTPL 120 Pseudomonas putida
BAC71413     316 GREFVESLARGLTVITSFGEGRSALTLTEVARATGLARATARRALITLEHLGYVTAQSGVFRLTPRVLGLGFPALSRTTL 395 Streptomyces av...
CAE53840      10 DRDYIQSIERGFAVLTAFDEKNPNPSLADLAAETGLSRPAVRRILLTLQKLGYVTGNNSRWSLTPRVLSIGQHFSASHAL 89  Rhodococcus ery...
BAB50896       7 SRDHVGSLERGLAVMEILARHPSGMTLTEMAEQAGLTRAGARRFLLTLVATGYATQDGRMFSLSPRLLAVARTWLGGGSL 86  Mesorhizobium l...
CAE26425      15 SAEFIESLSRGLRVIEAFGAEKRPMTLSDVAKACGLPRATARRILLTLQSAGYVSSDDRLFALTPRVLGLASAYLASNQI 94  Rhodopseudomona...
WP_004681922   3 ETDFVGGFAKGLRVIEAFGEDRPRLSIADVSKITGLDRATARRCLLTLAELGYAEYDGKFFMLLPRILRLGHAYLSGTPL 82  Brucella
Q43992        19 TEDYIAGLAKGLALLEAFGIDRQRLNVTQVAERTGISRTAARRYLKTLKFLGYLDTDEHYFWLTHRVLRFSSSYLSSAHL 98  Acinetobacter s...
2IA2_A        93 PEVAQPHLEKLSHKVHESSSVSILDGADIVYVARVPVSR-IXT-----VGITIGTRLPAYATSXGRVLLAGLPDDELDAY 166 Rhodococcus jos...
O83046       107 PKISQPLLNLLTTQTSLIYSVMVLDGYEAITIARSAAHQ-QTDrv-npYGLHLGNRLPAHATSAGKILLAYLDDHAQQEW 184 Acinetobacter s...
AAN68217      88 PRMLRPIVEQVARQTQEHVSVGTRDGDEIIHLVRSRYSH-VAS-----LSIRPGSRVPMYCTASGRIWLAWLDEGERDEY 161 Pseudomonas put...
Q52154       121 AISAQPYLDRISDQLHEAANMATLEGDDILYIARSATVErLIS-----VDLSVGGRLPAYCTSMGRILLAAMDDTSLREY 195 Pseudomonas putida
BAC71413     396 PDVAAPHLAALSRRVHESASLAVLAGDEIRYTARFTTSR-VMS-----VNITVGTRLPAYATSLGRVMLADLPEPHLPDP 469 Streptomyces av...
CAE53840      90 TEAALPRLLEIAEHTHESASLGVLDGVDVVYAARVPVRR-IMS-----INVSVGTRVPAYATSMGRALLAWAPTEIVDNV 163 Rhodococcus ery...
BAB50896      87 WSFAAPIMRTVAAQLNEACSAAILSGQDVVYVARIPGRR-ILS-----VSLDVGTRLPAYCTSMGRMLLAGLAPEELDEF 160 Mesorhizobium l...
CAE26425      95 SAVLQPLMDRVSASAKEVCSLAILDGDDAVFVARASPAR-VFS-----AGIDLGYRLPLFCTSVGRVLLSRLDNDELTAT 168 Rhodopseudomona...
WP_004681922  83 PTIIQPHLDRLSQSVGESASASVLDGAEIVYIARASQMR-VIS-----INLMAGSRLPAYCASMGRVLLAWLDESEARTI 156 Brucella
Q43992        99 PKVAQSFLNLLCAQTSLTFSIVVLDEHEVVPVARSYLPQ-QDNlrvspYGMHLGNRLPAHATSTGKVLLSVLDREVQIEW 177 Acinetobacter s...
2IA2_A       167 LEKLDIQRLTERTITARDELKAAILAVRADGICVLDQELEAGLRSXAAPIRGASGLTVAAVNISTPAARYSLEDLHSDLI 246 Rhodococcus jos...
O83046       185 LNQYPLQRLTKYTYTNNIDFLRLLSEIKEQGWCYSSEEHELGVHALAVPIYGQQSRVVAALNIVSPTMRTTKEYLIQHIL 264 Acinetobacter s...
AAN68217     162 FARHPLRALTPYTLTDRAQLDAELQRVKGQGFCIVDQEYEIGMRVLGVPLLGRAGQLKATLTITTHASRLSIDEIRLRYL 241 Pseudomonas put...
Q52154       196 LGRADLKARTSRTLHDPESLFACIQQVRAQGWCVVDQELEQGLRSIAVPIYDASGQVLAALNVSTHVGRVTRSELEQRFL 275 Pseudomonas putida
BAC71413     470 SDLVAP---TPRTVTDPEELRAVLDRVRRDGYALVDGELEEGLRSIAVPVRERGGRVVAAVNVALHSSRRTPEECVEEVL 546 Streptomyces av...
CAE53840     164 IANSTFDALTPTTITDEGAFHTALRVVREQGYALTSEELEDGLISLAAPVRDAGGSVVGVAACSTSAGRTTPEAFRTDVA 243 Rhodococcus ery...
BAB50896     161 LHQATIERRTPKTITDIGLLAEAIGKARADGFAIVDEELELGLRSIAVPIRDRAGNTVAAINVSTQSARFSVAEMEREIL 240 Mesorhizobium l...
CAE26425     169 INAMTLTKQTEDTITDKQTVIATIIADRTKGYSLVDREAEPGFRSVAVPIRRYDGTIVAAANIGAHVDRITTGEMIDRFL 248 Rhodopseudomona...
WP_004681922 157 LEQTELRARTPFTQKDPEKLMEELRRIRAQGFAVNDQELELGLRSIAVPVFNHRGAVVAALNIGAPVAHVEVSDLVGRIL 236 Brucella
Q43992       178 IEKYGLKRLTPYTITDEHTFLETLDAVRQSDYCLSTEEHELGLIAIAVPVLNAQGLTIAALNCMSQTNRVQPQYLIDQVL 257 Acinetobacter s...
2IA2_A       247 PSLRVTATDIEQDL 260 Rhodococcus jostii RHA1
O83046       265 PLLQETARELRNIL 278 Acinetobacter sp. ADP1
AAN68217     242 PTLYEAQALLRPVL 255 Pseudomonas putida KT2440
Q52154       276 PILLAASRDLCHQL 289 Pseudomonas putida
BAC71413     547 PELLATASRIEADL 560 Streptomyces avermitilis MA-4680 = NBRC 14893
CAE53840     244 PFLVEKANQLSADM 257 Rhodococcus erythropolis
BAB50896     241 PALLEARQRIEDFF 254 Mesorhizobium loti MAFF303099
CAE26425     249 PLLQTMAEEARPLM 262 Rhodopseudomonas palustris CGA009
WP_004681922 237 PEMLKIQSELRSML 250 Brucella
Q43992       258 PLLRNTANELRNLV 271 Acinetobacter sp. ADP1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap