Conserved Protein Domain Family
TIGR02270

?
TIGR02270: TIGR02270 
conserved hypothetical protein
Members are found in Myxococcus xanthus (six members), Geobacter sulfurreducens, and Pseudomonas aeruginosa; a short protein homologous to the N-terminal region is found in Mesorhizobium loti. All sequence are from Proteobacteria. The function is unknown. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 131323
View PSSM: TIGR02270
Aligned: 4 rows
Threshold Bit Score: 474.74
Threshold Setting Gi: 499871444
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAR36571       4 TISSILHQLAEEAAFLWHLRGGILQSPHFSLSDLERFDERLEAQVDGLRVGG-DASWEICRSALPGDTVEGLFAPAVLAF 82  Geobacter sulfu...
WP_003115068   2 SIAAIVDQHAEEAAFLALLRDYAVRAPHYDLEELAELDQRIEAHLDGLAIAG-QAGHDALLEQLDAHAQGEAFALAVLAM 80  Pseudomonas aer...
WP_011551422  12 ISWEMLASHLDEAGFLWRQWKRALVAPDHVVDDVAGVEARLLAHVDALVLAGrKAATRLLVPALAEADEPGRVECAALGL 91  Myxococcus xanthus
WP_011552178   1 MMLDVLEEHLSEAAFFWSQWERALVAPDYTLEETAELEERLLAHLDGLVAAG-AAAIEVLSSVVYEREDPGEVFAAAWSL 79  Myxococcus xanthus
AAR36571      83 EGVNSEH---LQQVMDAMGTDRE-KARAVISALGWLPYEQARPRIEQLLADESPFHR-YIGMAACAIHRHDPGPQLTRAV 157 Geobacter sulfu...
WP_003115068  81 QAGDDAL---IGRMRACLAASPE-ARRGFAAALGWLDWDQARPWVERLLASPEPLFR-AIGLAACGMHRHDPGPALLSAL 155 Pseudomonas aer...
WP_011551422  92 LLQEDALdgaVRSVLEVLQAGEEgLCAGIQAALLCAGGRGLESWLRPMVDASPPPGGlATLLEILGAWRVDPGPALEASL 171 Myxococcus xanthus
WP_011552178  80 LALAPSLv--LDAVKARATDAPPpVQASIRRALELGEKGVVETALAPLLTTAEP-----MAVSVLGFRGHLLGGRAEELL 152 Myxococcus xanthus
AAR36571     158 NDTSPLLMARGLRAYGELGRGCELNDFRlqEYLTDHDDEIRFAAAWSASLAGIGTAVGVLRSFVASSSRYAEKALNVSVR 237 Geobacter sulfu...
WP_003115068 156 GHADPAVLARAARTAGELRRRDLMANIR--AYRAHDDPSLRFWANWATAQMGDEEALGPLRAFAGQPGPFQLPATMVLLA 233 Pseudomonas aer...
WP_011551422 172 THEAAQVRAAAFRCLRSWPVRLSESTLE--LGLRSSSAEVSGAALEAGLLAGSRLAWWECRR-QVLEGGPHRQRALRALA 248 Myxococcus xanthus
WP_011552178 153 SHPDALVVTAALRALNLSSKSHAPRLLG--VLLGDSRPEVRWAAIETGLVFGVRDAWTVCERESTAMGSPLRRRLWALLA 230 Myxococcus xanthus
AAR36571     238 CMRPESARAWQRELAQSSETIRFAAICAGALGDPSLVPWLIDRMDTPT-IARVAGEALTMITGIDIELEELAGS-RPEGF 315 Geobacter sulfu...
WP_003115068 234 WQPRDTSMAWIRQLMQAADTRRIGIQATGLFGDPVAVPWLIQQMRDES-LARVAGEAFSLITGADLALLDLELE-ALPDY 311 Pseudomonas aer...
WP_011551422 249 VAGGPDAQKLLLEGLGDAARGTETLRVVGLVGTVETARACLEAMREPP-WARLAAESFSLVTGMEVP-----------AV 316 Myxococcus xanthus
WP_011552178 231 AAGNVRFLERLISFSEAAATREDALWALGFTGQVPAAESCLRWMCEEPrVARLAGEAFSAITGLRMAGAHVLPEpEPEDA 310 Myxococcus xanthus
AAR36571     316 NAGPTDDPKDLNVAMDADENLPWPDADRVAAWWGKNKGRFQSGTRYFLGKPVSPEHLRLALKTGLQRQRAAAALELARMN 395 Geobacter sulfu...
WP_003115068 312 DPGPNDDLDDDNVALDDDENLSWPEAERVSAWWRDNGARFVAGRAYLLGEPLGEARCRQVLRDGQQRQRMAAACLLARFV 391 Pseudomonas aer...
WP_011551422 317 APGVESGDEAAAVEFAPEADLPLPDVPRVEAWWAEHAPRFKPTVRYVRGRPLGQESLLDALREGSMYRRRSLWWAVALRT 396 Myxococcus xanthus
WP_011552178 311 LPPLEDEDLDADLGLRPEDALALPAQEEVARWWERARDGFSPANRYLRGKPFTGASLLEALAQGPMRRRHLYALELMVRT 390 Myxococcus xanthus
AAR36571     396 PGRPMFEVRAPAARQRKE 413 Geobacter sulfurreducens PCA
WP_003115068 392 PNLPLFPTGAPVRRQLDL 409 Pseudomonas aeruginosa
WP_011551422 397 RGALGLGVGAWTRTQRAE 414 Myxococcus xanthus
WP_011552178 391 RGAYAIQVRAFTSRQREQ 408 Myxococcus xanthus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap