Conserved Protein Domain Family
benz_CoA_red_D

?
TIGR02261: benz_CoA_red_D 
benzoyl-CoA reductase, bcr type, subunit D
This model describes the D subunit of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This family shows sequence similarity to the A subunit (TIGR02259) and to the 2-hydroxyglutaryl-CoA dehydratase alpha chain.
Statistics
?
PSSM-Id: 131314
View PSSM: TIGR02261
Aligned: 2 rows
Threshold Bit Score: 507.262
Threshold Setting Gi: 39647584
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAE26104   2 TITSGIDVGTGAIKVVVFEVDGDQERCLGKRVERVRQRDPLKLAGDIYDDLLRETGLARADVAYCATTGEGESLTFHTGH 81  Rhodopseudomonas pa...
CAA12250   2 TITAGIDIGTGAVKTVLFRVEGDKTEWLAKRNDRIRQRDPFKLAEEAYNGLLEEAGLKASDVDYVATTGEGESLAFHTGH 81  Thauera aromatica
CAE26104  82 FYSMTTHARGAIYLNPGSRAVLDTGALHGRAIRMDERGKVLAYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSQRADN 161 Rhodopseudomonas pa...
CAA12250  82 FYSMTTHARGAVYLNPEARAVLDIGALHGRAIRNDERGKVETYKMTSQCASGSGQFLENIARYLGIAQDEIGSLSTQADN 161 Thauera aromatica
CAE26104 162 PEKVSGICAVLAETDVINMVSRGISSPNILRGIHESMADRLAKLLKTLGSLDGTVQMTGGLALDAGLVEAMKDAVVKAKV 241 Rhodopseudomonas pa...
CAA12250 162 PEVVSSICAVLAETDVINMVSRGISAPNILKGIHISMAGRLAKLLKSVGARDGVVLCTGGLALDEGLLKTLNESIQEQKM 241 Thauera aromatica
CAE26104 242 DVAIESHPDAIYAGAIGAALWG 263 Rhodopseudomonas palustris CGA009
CAA12250 242 AVVAYNHPDSPYAGAIGAALWG 263 Thauera aromatica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap