2AGK


Conserved Protein Domain Family
hisA_euk

?
TIGR02129: hisA_euk 
Click on image for an interactive view with Cn3D
phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type
This enzyme acts in the biosynthesis of histidine and has been characterized in S. cerevisiae and Arabidopsis where it complements the E. coli HisA gene. In eukaryotes the gene is known as HIS6. In bacteria, this gene is found in Fibrobacter succinogenes, presumably due to lateral gene transfer from plants in the rumen gut. [Amino acid biosynthesis, Histidine family]
Statistics
?
PSSM-Id: 162719
View PSSM: TIGR02129
Aligned: 6 rows
Threshold Bit Score: 431.515
Threshold Setting Gi: 10444341
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2AGK_A         1 TKFIGCIDLHNGEVKQIVGGTLT---SK--KEDVPKTNFVSQHPSSYYAKLYKDRDVQGCHVIKLGPN--NDDAAREALQ 73  baker's yeast
P40545         2 TKFIGCIDLHNGEVKQIVGGTLT---SK--KEDVPKTNFVSQHPSSYYAKLYKDRDVQGCHVIKLGPN--NDDAAREALQ 74  Saccharomyces c...
Q10184         7 TLFRPCIDIHQGQVKQIVGGTLG-------NDADVKTNYVSLKPSSYYAELYKLNHLEGAHVIMLGPN--CEEAAKTALH 77  Schizosaccharom...
BAA32457      44 VQFRPCIDIHKGKVKQIVGSTLRdl-kE--DGSVLVTNFESDKSAEEYAKMYKEDGLTGGHVIMLGADplSQAAAIGALH 120 thale cress
WP_014546881   2 TKFRPCIDLHDGKVKQIVGSSLSd------sGAGLKTNFETDRSSAWFAELYKKDGIKGGHVIMLGKG--NESAAKDALS 73  Fibrobacter suc...
AAG17873       2 TKFRGCIDIHSGQVKQIVGGTLTqddSAssKTSSAKENFVSTKPSSHYAQLYKDYNVKGCHVIKLGSNpaNDDAAKLALS 81  Candida albicans
2AGK_A        74 ESPQFLQVGGGINDTNCLEWLKW-ASKVIVTSWLFTKEGh----FQLKRLERLTELCGKDRIVVDLSCRKT--QDG---R 143 baker's yeast
P40545        75 ESPQFLQVGGGINDTNCLEWLKW-ASKVIVTSWLFTKEGh----FQLKRLERLTELCGKDRIVVDLSCRKT--QDG---R 144 Saccharomyces c...
Q10184        78 TWPGALQIGGGINISNAQNWLQEgASKVIVTSWLFPDAQ-----FDLDRLKAISSKIGKDRLVVDVSCRR---KDN---R 146 Schizosaccharom...
BAA32457     121 AYPGGLQVGGGINSENCMSYIEEgASHVIVTSYVFNNGK-----IDLERLKDIVSIVGKQRLILDLSCRKK---DGr--- 189 thale cress
WP_014546881  74 AYPGGMQVGGGINAQNAKEYIDAgASHVIVTSWIFPDGK-----LDRSRLDELVKTVGKEHLILDLSCKRTgmVNGk-pQ 147 Fibrobacter suc...
AAG17873      82 TWPHNLQVGGGINLDNAQYWLDQgASHVILTSWLFTKNEqdkmeLDFGKLREISKLIGKEKLIVDLSCRTV--IENgktN 159 Candida albicans
2AGK_A       144 WIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAADVEGLCGGIDELLVSKLFEWTKdyddLKIVYAGGAKSVDDLKLV 223 baker's yeast
P40545       145 WIVAMNKWQTLTDLELNADTFRELRKYTNEFLIHAADVEGLCGGIDELLVSKLFEWTKdyddLKIVYAGGAKSVDDLKLV 224 Saccharomyces c...
Q10184       147 WFAAINKWQVMTAFELNEENLDLLSQYCSEFLIHAADVEGLCKGIDEDLVIKLGEWVK----IPTTYAGGGRSIEDLDLV 222 Schizosaccharom...
BAA32457     190 YAIVTDRWQKFSDVILDEKSLEFLGGFSDEFLVHGVDVEGKKLGIDEELVALLGNYSP----IPVTYAGGVTVMDDVERI 265 thale cress
WP_014546881 148 WKIATNRWQTIIDIEINKETLEDLAKSCDEFLVHAADVEGKQQGMDDELIKFLAENSP----IPVTYAGGAKSLEDLIHC 223 Fibrobacter suc...
AAG17873     160 WYVAMNKWQTITDTILSAEFLLKVSAYCDEFLIHAADVEGLCKGIDEKLVENLGEWCPvgfeEKIVYAGGAKSINDLDTV 239 Candida albicans
2AGK_A       224 DELSHGKVDLTFGSSLDIFGGNLVKFEDCCRWNE 257 baker's yeast
P40545       225 DELSHGKVDLTFGSSLDIFGGNLVKFEDCCRWNE 258 Saccharomyces cerevisiae S288c
Q10184       223 DKLSKGKVDLTIGSALDIFGG-VLEFTRVVAWNR 255 Schizosaccharomyces pombe 972h-
BAA32457     266 KDAGKGRVDVTVGSALDIFGGN-LPYKDVVAWHH 298 thale cress
WP_014546881 224 KEISNGKIDLTIGSALDLFGGKGVMYDDCVKFNK 257 Fibrobacter succinogenes
AAG17873     240 AKLSKGKVDLTYGSSLDIFSGKLVNFTDLVEWNK 273 Candida albicans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap