2VNC


Conserved Protein Domain Family
glgX_debranch

?
TIGR02100: glgX_debranch 
Click on image for an interactive view with Cn3D
glycogen debranching enzyme GlgX
This family consists of the GlgX protein from the E. coli glycogen operon and probable equivalogs from other prokaryotic species. GlgX is not required for glycogen biosynthesis, but instead acts as a debranching enzyme for glycogen catabolism. This model distinguishes GlgX from pullanases and other related proteins that also operate on alpha-1,6-glycosidic linkages. In the wide band between the trusted and noise cutoffs are functionally similar enzymes, mostly from plants, that act similarly but usually are termed isoamylase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 131155
View PSSM: TIGR02100
Aligned: 13 rows
Threshold Bit Score: 1038.46
Threshold Setting Gi: 42558986
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2VNC_A        14 PGDPYPLGSNWieDD----D-----GVNFSLFSENAEKVELLLYSLTNQ-KyPKEIIEVKNKTGDIWHVFVPGLRPGQLY 83  Sulfolobus solf...
CAE33357      11 PGLPAPLGATS--DG----L-----GVNFAVFSANAARIELCLFDARGR-K-ELARLPMPECTDEVWHGYLPDAQPGLVY 77  Bordetella bron...
AAM81590      14 PGDPYPLGSNW--IEd--eD-----GVNFSLFSENAEKVELFLYSQTNQkY-PKEIIEVKNKTGDIWHVFIPGLRPGQLY 83  Sulfolobus shib...
P45178         7 NGNPIPMGYSQ--AVennvQ-----ITNFALFSAAAIGVELCLFDEQN----QETRLPMVRTEN-VWHLAVTGVKTGTEY 74  Haemophilus inf...
WP_010954850  19 EGMPFPLGATW--DG----L-----GVNFALFSANATKVELCLFDSTGE-Q-ELERIELPEYTDEIYHGYLPDAHPGLVY 85  Pseudomonas putida
WP_000210601  11 SGYSHTLGANY--DG----E-----GVNFAIFSAHAERVELCLYDPSGE-H-EIARLELPEYTDEIWHGYVPKLQPGALY 77  Salmonella ente...
WP_011071679  19 AGKAFPLGATV--DD----G-----GVNFALFSAHATGVELCLFDAQGK-V-EIQRIALTEQTQQIWHLYVHGLCAGQLY 85  Shewanella onei...
WP_010976095   9 DFMKPELGAEY--TG----Q-----GTHFAVFSAHAEKIELCLFSEDGR-E-ETARMPLPKREGDIWSGYIEGIGPGTLY 75  Sinorhizobium m...
WP_010886909  10 PGSPFPLGATW--DG----K-----GTNFALYSENATGVELCLFDAEG----HETRFPLTEQTAFVWHGYLPGIQPGQRY 74  Deinococcus rad...
WP_011030259  71 pGTPVPLGARF--RT----GpdqvaGTNFALWAGGAEAVELCLFDGPGPgA-RESRVRLTELTHEIWHGFVPGVRPGQRY 143 Streptomyces co...
Q8KR69         6 AGRPRPLGSHF--DG----E-----GVNFALFSSGASRVELCIFDGLRE-Q----RLPLTARTGDIWHGYLPDAQPGLCY 69  Erwinia chrysan...
WP_010973544   3 IPPVFPKGATR--TE----N-----GVEFTVYSRHASQIDLCLFDDAGE-K-ETARLPMMRGEDDVHRLTHENAGPGTRY 69  Agrobacterium f...
BAC52034       5 AGSPARLGASW--DG----R-----GTNFALFSANAQKVELCLFDTQGR-R-ELERVELPERTEDVWHGYLNDVSPGQLY 71  Bradyrhizobium ...
2VNC_A        84 AYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWNDAVFGYKIGDQNQDLT---YDERDSGEYVPKSVVINP-Y-FEW 158 Sulfolobus solf...
CAE33357      78 GYRAHGPYNPRAGHRFNPHKLLLDPYATALTGALRWSDALFGYRMQHPRADLS---MDRRDSAAGVPKAVVTEP-A-FHW 152 Bordetella bron...
AAM81590      84 AYRVYGPYKPELGLRFNPNKVLIDPYAKAINGNVIWNDAVFGYKIGDQNQDLS---YDERDSSEYVPKSVVINP-Y-FEW 158 Sulfolobus shib...
P45178        75 AFRIHG-------EFANPQKLILDPYAKAVNGKPDLSSEESRSWFLLSDN---------RDNAHLAPRAVVISE-E-FDW 136 Haemophilus inf...
WP_010954850  86 GYRVYGPYEPENGHRFNPNKLLIDPYAKQLVGSLKWSEALFGYTIGHPDGDLS---FDERDSAPFVPKCKVIDP-A-FTW 160 Pseudomonas putida
WP_000210601  78 GYRVYGPYDPENGHRFNPNKLLIDPYARELVGDIQWNDAHFAYQLLHDDKDLT---FDDQDSAPFTPKCRVIDP-DeANW 153 Salmonella ente...
WP_011071679  86 GYRVYGPYEPQLGHRFNPHKLLLDPYARQLVGRYHHHIANFGYELDNPNEDLS---FSTLDNAAYMPKCKVVDIrP-LLA 161 Shewanella onei...
WP_010976095  76 GYRAHGPYDPHNGHRFNPNKLLLDPYAKLVAGDLIWDDALFGYTIGSPEGDLS---FDERDSAPFMVKGVVQDP-T-FDW 150 Sinorhizobium m...
WP_010886909  75 GYRVHGEYAPEKGLRFNPNVVLLDPYAKALDGTEQFDRGVFGYVAGGEDD--S---QMQEEEQRGAPLGLVVDP-M-FNW 147 Deinococcus rad...
WP_011030259 144 GYRVHGRWDPWTGARWNPAKLLLDPYARAVDGDFGLPPEVYGHVRDWPEQRVAdtvRDDRDSAPHVPKGVVVHD-D-DD- 220 Streptomyces co...
Q8KR69        70 GYRVDGAFDPSRGQRFNANKLLLDPCARQMDGWVV-DDQRLHGGYHQPDP---------SDSAEVMPPSVVVDE-H-YDW 137 Erwinia chrysan...
WP_010973544  70 GFRAHGIYAPEHGLWFDPAKLLLDPYATEIDRPFRHDPSLYAF---------------GAETGAIMPKAILSAH-D-PVK 132 Agrobacterium f...
BAC52034      72 GYRVHGPYEPEHGHRFNANKLLLDPYAKRLSGRLVWSDAHFAYRTGSPREDLS---FDRRDNARGMPKAVVVDE-T-FNW 146 Bradyrhizobium ...
2VNC_A       159 DdEdfiKGKK--------VPLKDTVIYEVHVKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHFIDQ 230 Sulfolobus solf...
CAE33357     153 G-At--RRPA--------TAWAHTVIYEAHVRGVSMLRSDLREPIRGTCAALADPRFIDHLHRLGVTALELMPVHAFLQD 221 Bordetella bron...
AAM81590     159 DdEnfiKGKK--------VPLKDTVIYEVHVKGFTKLRLDLPENLRGTYEGLASEQMISYLKDLGITTVELMPVFHFIDQ 230 Sulfolobus shib...
P45178       137 EnD---TSPN--------TPWAETIVYELHVKGFSQLNEKIPAALRGTYTGLAHPVNLAYLKELGVTAVELLPVNFHINE 205 Haemophilus inf...
WP_010954850 161 GrD---QRVQ--------IPWERTIIYEAHARGISMRHPAVPEELRGTFAGLANDELLKHIKDLGVSSIELLPIHAFVND 229 Pseudomonas putida
WP_000210601 154 E-Dr--QRPS--------IPWSNAIIYETHVKGFTQLNSAIPEPLRGTFEGMGHKASVDYIKSLGITSVELLPVHWFPDD 222 Salmonella ente...
WP_011071679 162 AaEs--QAIRplsphrnpLPIEQCIIYEMHLKGFTALHPEIDVPLRGTFAGLASKAAIDYLVKLGVNCVELLPIQAFFSE 239 Shewanella onei...
WP_010976095 151 AgEe---AIR--------RPWTETIIYESHVRGMTMTHPGVPDELRGTFLGMASDPIIEHLTKLGVSAIELMPVQYFLDD 219 Sinorhizobium m...
WP_010886909 148 VgD---QKPG--------IPFHQSVIYEAHVKGLTMTHPDVPEELRGTYAGVATPAILDYLRDLGITAIEFLPVHQHVDD 216 Deinococcus rad...
WP_011030259 221 WsDd--RRPK--------TPWADSVIYELHVRGFTKLHPEIPPELRGTYAGLAHPAAIAHLTRLGVTAVELLPVHQFAHE 290 Streptomyces co...
Q8KR69       138 QgD---RLPR--------TPWSQTVLYEAHVRGLTRRHPGIPAAIRGTYAALAHPVMLDYLTQLGVTALELMPVQQHADE 206 Erwinia chrysan...
WP_010973544 133 R-----QPPR---------FAEGGLIYELAVKSFTQLHPYVPEDIRGTVAALAHPAILAHLKKIGVDAVELMPITAWIDE 198 Agrobacterium f...
BAC52034     147 GrRe--IRPN--------IAWEDTIIYEAHVKGLTQKRDDVPPNLRGTYGGLSSPAMIEHLKKLGVTTIELLPIHSFVDD 216 Bradyrhizobium ...
2VNC_A       231 RFLTDKGLTNYWGYDPINFFSPECRYSStg---clGG----QVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNHLGPTLS 303 Sulfolobus solf...
CAE33357     222 RTLVERGLRNYWGYNTLAYFAPEPAYLA-------DG----QPHDLRRAIRRLHAAGIEVILDVVYNHTCEGNELGPTLS 290 Bordetella bron...
AAM81590     231 RFLIDKGLTNYWGYDPINFFSPECRYSS-------SGclgeQVISFKRMVNKLHNAGIEVIIDVVYNHTAEGNHLGPTLS 303 Sulfolobus shib...
P45178       206 PHLQARGLQNYWGYNPLAMFAVEPKYAA-------TNn---PLAEFKTMVKAFHKAGIEVILDVVFNHSAESEQTYPTFS 275 Haemophilus inf...
WP_010954850 230 QHLLDKGLNNYWGYNSIAFFAPHPRYLA-------SG----KIAEFKEMVAHLHDAGLEVILDVVYNHTAEGNERGPTLS 298 Pseudomonas putida
WP_000210601 223 QHLLDKGLKNFWGYNSLGFFAPATRYYG-------PK----GIQGFRDMVRAFHDAGIEVILDVVYNHTAEGNELGPTLS 291 Salmonella ente...
WP_011071679 240 PFLLEKQLSNYWGYNSIGFFAPEPSYLS-------SE----DIIEFRTMVDALHGAGIEVILDVVYNHSAEGSRLGPTFS 308 Shewanella onei...
WP_010976095 220 RYLVERNLRNYWGYQTLGFFAPHDRYLK-------GD----RFTEFKTMVKRFHSVGIEVLMDVVYNHTAEGSERGPTLS 288 Sinorhizobium m...
WP_010886909 217 PFLLDKGLTNYWGYSTLNFFAPDVRYSAearkgnpSG----AVPEFKNMVRALHDAGIEVILDVVYNHTAEGNHMGPTMS 292 Deinococcus rad...
WP_011030259 291 SHLLERGLRNYWGYNSVGYFAPHAGYTA-------SGttgeQVGEFKRMVRALHAAGIEVILDVVYNHTAEAGELGPTLS 363 Streptomyces co...
Q8KR69       207 PRLQSMGLRNYWGYNTLLPFAVDNSLAA-------SDd---PLNEFRDTVRALHQAGIEVILDVVFNHSAELDVDGPTLT 276 Erwinia chrysan...
WP_010973544 199 RHLPPLGLSNAWGYNPVGFIALDPRLCP-------GG-----VRELRDTVAALHAEGIGVILDLVFNHTGESDIEGSILS 266 Agrobacterium f...
BAC52034     217 RILVEKKLANYWGYNTLSFFAPEPRYAQ-------DN----ALDSFRTTVARLHDAGIEVMLDVVYNHTAEGNHLGPTLC 285 Bradyrhizobium ...
2VNC_A       304 FRGIDNTAYYMLQPdNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAALARELYSVNMLNTFFI 383 Sulfolobus solf...
CAE33357     291 WRGLDNASYYRLVPgDERRYIDDTGTGNTLNLSHPRVLQMVMDSLRHWTTHYRVDGFRFDLGVTLGREGTGFDAGSGFFD 370 Bordetella bron...
AAM81590     304 FRGIDNTAYYMLQPdNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAALARELYSVNMLNTFFI 383 Sulfolobus shib...
P45178       276 QRGIDDQTYYWRND--QGRYINWTGCGNMLNLSSDVGRKWVVDCLRYWVEQCHIDGFRFDLATVLGRDTPDFNSSAQLFT 353 Haemophilus inf...
WP_010954850 299 MRGIDNASYYRLMPdDKRYYINDSGTGNTLDLSHPCVLQLVTDSLRYWAGEMHVDGFRFDLATILGRYHDGYSERHGFLV 378 Pseudomonas putida
WP_000210601 292 FKGIDNFSYYRTMPdQHRYYINDTGTGNTVNTSHPRVLQMVMDSLRYWAESMHVDGFRFDLGTILGREPEGFDQRGGFFD 371 Salmonella ente...
WP_011071679 309 FRGIDNLSYYRLHPnDKRFYINDTGCGNTLNLNHPRMLQLVLDSLRYWVKVMGVDGFRFDLAASLGREAYGFDPGSGFFD 388 Shewanella onei...
WP_010976095 289 FRGLDNFSYYRQSPdKPRHTYDTTGTGNTLNVAHPLVLRMVLDSLRYWVGVMHIDGFRFDLASTLGREYMEFDREGGFFD 368 Sinorhizobium m...
WP_010886909 293 FKGIDNPTYYRLVAdDQRFYFDYTGTGNSLNVRHPQTLQLIMDSLRYWVTEMHVDGFRFDLASTLARGLHEVDQLSGFFT 372 Deinococcus rad...
WP_011030259 364 LKGIDNRGYYRLQPd-ARRYADYTGCGNTLHVVQPHVLRLITDSLRYWVTEMGVDGFRFDLAAALARSMHDVDMLSPFLA 442 Streptomyces co...
Q8KR69       277 LRGIDNASYYWLTEn--GDYHNWAGCGNVLRLEHPAVLHWVIECLTFWHEVCHVDGFRFDLATILGR-LPDFSSSAPFFT 353 Erwinia chrysan...
WP_010973544 267 LRGLDNLTAFRHPQgKPGVLVNDTGTGNTVACDHPYIRQLIVDSLRHFVLNAGVDGFRFDLAPVLGRTAAGFDMASETLA 346 Agrobacterium f...
BAC52034     286 YRGIDNASYYWLNReNPRYYDDFTGCGSSVNLTHPRVLQMVMDSLRYWVEVCHVDGFRFDLATTLARGPNGFDRGSSLLT 365 Bradyrhizobium ...
2VNC_A       384 ALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRGEALPYSEIANRLLGSPDIYLGNNKTPFAS 463 Sulfolobus solf...
CAE33357     371 ALLQDPVLARVKLISEPWDVGPDGYQLGRHPPGMAEWNDQFRDTARRFWRGDPGMAGALATRLTASRDVFDHRHRRPWSS 450 Bordetella bron...
AAM81590     384 ALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRGEALPYSEIANRLLGSPDIYLGNNKTPFAS 463 Sulfolobus shib...
P45178       354 DIKNEPSLQNIKLIAEPWDIGHYGYQVGNFPSYFAEWNDRFRDDLCRFWLWKSGEIGAFAERFAGSSDLFKKNDRLPHTT 433 Haemophilus inf...
WP_010954850 379 ACRQDPMLSQVKLIAEPWDCGPGGYQVGNFAPGWAEWNDRFRDTARAFWKGDEGQLADFAARLTASGDMFNNRGRRPYSS 458 Pseudomonas putida
WP_000210601 372 AVTQDPVLAKLKLIGEPWDIGPGGYQVGGFPPGWGEWNDKYRDTVREYWKGDN-VTNDFAARLLGSGDLYDLRGRRPWSS 450 Salmonella ente...
WP_011071679 389 ALLQDPVLCRVKLIAEPWDIGPGGYQLGNFPVAFSEWNDRYRDTMRRFWRGDHGMLPEFARRFHGSGDFFEHSGRPPAAS 468 Shewanella onei...
WP_010976095 369 AIRQDPILAGVKLIAEPWDVGEGGYQLGGFPPPFREWNDRFRDDVRRFWKGDGGMVPVLAERILGSPVQFRHSDRAATSS 448 Sinorhizobium m...
WP_010886909 373 IIHQDPIISQVKLIAEPWDVGEGGYQVGNFPVNWAEWNGIYRDDMRSFWKGEGGLASEIGYRITGSSDLYEFNGRKPYAS 452 Deinococcus rad...
WP_011030259 443 VIAQDPVLRRVKLIAEPWDVGSGGYQVGAFPPLWTEWNDRYRNAVRDFWRHALPDVREMGYRLSGSSDLYAWGGRRPYAS 522 Streptomyces co...
Q8KR69       354 ALRNHRSLRDCKLIAEPWDISPGGYQLGQFPAPFAEWNDRFRDDMRRFWLHGDLPIGVLARRFAASSEVFERGSRQPWAS 433 Erwinia chrysan...
WP_010973544 347 AMHSDPVLYDRLLIAEPWDIGPGGYQLGNFPESFLEWNDRARDDMRRFWRGDAGTTGALANALSGSSPIFSRHGRLKSRS 426 Agrobacterium f...
BAC52034     366 AIRQDPVLAAVKLVAEPWDLGLGGYQVGAFPSQWSEWNDRYRSAMRRYWSGEGSLIGDISSRMTASSDLFNHDGRRPRAS 445 Bradyrhizobium ...
2VNC_A       464 INYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAEG------PTNDQNVVICREKQKRNFMITLLVSQGT 537 Sulfolobus solf...
CAE33357     451 INFAAAHDGFTLQDVVSFAERHNEANGEDGADGHGENYSSNWGVEG------AASSAVIRETRARVQRALLATVMLADGT 524 Bordetella bron...
AAM81590     464 INYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGTEG------TTNDQNVIMCREKQKRNFMITLLVSQGT 537 Sulfolobus shib...
P45178       434 LNFITAHDGFTLKDLVSYNQKHNETNGEENRDGRNENYSYNHGVEGsteslsEPQKSAVENNRTFAQSGLLMSLLLANGT 513 Haemophilus inf...
WP_010954850 459 VNFITAHDGFTLRDLVSYNHKHNEDNDENNQDGTDNNLSWNCGVEG------PTDDPAINALRMRQMRNYFATLLLAQGT 532 Pseudomonas putida
WP_000210601 451 VNFITAHDGFTLNDLVSYNDKHNEANGEDNNDGHNDNRSCNYGAEG------PTDDEGINAIRERQKRNFLTTLLFSHGT 524 Salmonella ente...
WP_011071679 469 INFLTSHDGFTLKDLVSYCERHNWANGEENRDGHHANFSYHYGVEG------ASNDVSVLVLRARQQRNLLTTLFLSQGV 542 Shewanella onei...
WP_010976095 449 INLVSAHDGFTLMDTVSYGEKHNEANGEENRDGHSDNHSDNMGAEG------PTDNREIIEARKRRRAAMLATLMISQGV 522 Sinorhizobium m...
WP_010886909 453 INFVTAHDGFTLRDSVTYEQKHNEANGEGNNDGHNHNITWNCGVEG------PTDDPEINRLRGQQMRNFLATLLLGQGT 526 Deinococcus rad...
WP_011030259 523 VNFVTAHDGFTLRDLVSYERKHNEANGEGNRDGTDDNRSWNCGTEG------ETDDAQVRALRRRQLRNLLTTLLLSTGV 596 Streptomyces co...
Q8KR69       434 VNMLTSHDGFTLRDLVCFNHKHNDANGEQNRDGTNSNFSFNHGTEG------LEADETTQARRRVSQQALLTTLLLSQGT 507 Erwinia chrysan...
WP_010973544 427 VNFLAAHDGFTLFDLVSHERKHNEKNGENNRDGHNDNHSWNNGFEG------LTDDPAIVAARLADVKALLSTLFVSRGT 500 Agrobacterium f...
BAC52034     446 INHITVHDGFTLADLFSYNEKHNEANGEDNRDGSNDNHSNNCGVEG------PTDDPGILGLRRQLRKNVLACLMLAQGV 519 Bradyrhizobium ...
2VNC_A       538 PMILGGDELSRTQRGNNNAFCQDNEITWFDWNL--D--E-RKsKFLEFVKKMIQFYRAHPAFRRERYFQGK-KLfG---- 607 Sulfolobus solf...
CAE33357     525 PMLLAGDEFGNSQGGNNNAYCQDGPMGWLDWAV--AqsTpGR-ALTAYAARLAGLRRAHPSLRATRYGDPA-HQwQ---- 596 Bordetella bron...
AAM81590     538 PMILGGDELSRTQRGNNNAFCQDNEITWFDWNL--D--ErKS-KFLEFVKKMIQFYKAHPVFRRERYFQGK-KLfG---- 607 Sulfolobus shib...
P45178       514 PMLLAGDEFGNTQYGNNNAYCQDNEITWLKWA------NfNE-ELFELTKQTIALRKQIGSLNKDQWWSDE-N------- 578 Haemophilus inf...
WP_010954850 533 PMIVAGDEFSRTQHGNNNAYCQDSEIGWVNWDL--D--E-EGqELLAFVKRLTRLRLAYPVLRRSRFLVGDyNE-A---- 602 Pseudomonas putida
WP_000210601 525 PMLLAGDEFGRSQMGNNNGYCQDSEISWVHWDN--Lp-E-TAnALREFTRHLIQLRATQPLLRRESWRDG---------- 590 Salmonella ente...
WP_011071679 543 PMLLSGDETGRTQGGNNNAYCQDNPMNWFDWSS--E--G-MDkHLLSFTQQLIALRKRFPLLCAKRFIHEQ-LV-Arsle 615 Shewanella onei...
WP_010976095 523 PMVLGGDELGNSQQGNNNAYCQDNEIGWLDWSG--A-----DdGFVDFCRKLLAFRKDRPVLRQERFLDGE-PD-E---- 589 Sinorhizobium m...
WP_010886909 527 PMILGGDEFGRTQGGNNNAYCQDNDISWYDW----E--K-VDeELLAFTRKLIALRKAHPSLHRRKFFAGR-NIrG---- 594 Deinococcus rad...
WP_011030259 597 PMLVAGDEMGRTQRGSNNAYCQDNETGWVDWSLrdD--P-EWaPLFALASRLIGLRHRHPVLRRRAFFSGR-AHsA---- 668 Streptomyces co...
Q8KR69       508 PMLLAGDEFGNSQQGNNNAYCQDNALAWLHWD------Q-ADdALLAFTSGLIRLRRSIPALQRGRWWRDD-DE-D---- 574 Erwinia chrysan...
WP_010973544 501 LMLTAGDEGGRSQQGNNNAYCQDNEISWVDWSS--L-----VpELIDHTAFLAALRKRFGVFSESGFFSGR--------- 564 Agrobacterium f...
BAC52034     520 PLLLAGDEVGNSQSGNNNAYCQDNEVGWVGWGN--LgkD-GD-DMVDFVAGLADIRRRFSQLRSHRWLDGR-PK-D---- 589 Bradyrhizobium ...
2VNC_A       608 --------------MPLKDVTFYTLEGREVDEKTWSSP-TQLVIFV-----LegS-----VMDEINmygeriadDSFLII 662 Sulfolobus solf...
CAE33357     597 --------------EGLGAIDWFNGRGAPMTSADWDAPeGRLLVLR-----R--A-----LPDPAQpg----rvDVTLLL 646 Bordetella bron...
AAM81590     608 --------------MPLKDVTFYTSDGKEVDEKTWNSP-TQTVIFV-----L--Eg---sVMDEINiygeriadDSFLII 662 Sulfolobus shib...
P45178       579 -------------------VQWLNIVGEPMTVEDWQNQqTKALQVV-----L--Dn-------------------rWLLL 613 Haemophilus inf...
WP_010954850 603 --------------IGVKDVTWLAPDGSEMSVEQWEDPhGRCLGML-----I--D-----GRAQVSgiarpgaeATVLLI 656 Pseudomonas putida
WP_000210601 591 -----------------LEIRWFNAGGGAQQSEQWDEGsTIGVCIS-----R--P-----DLQPEAgiw---hdA--LLL 636 Salmonella ente...
WP_011071679 616 spsesplgaakfltQPSARLDWFSRQGKPMTKSLWSESmCRSLCVV-----L--Sg----DLTAGIdvagdnsfQALLLM 684 Shewanella onei...
WP_010976095 590 --------------NGRVEIAWYKADGSPMDEDAWHDAeLRLICAY-----I--C-----RAGQGEapp---agEIVLVL 640 Sinorhizobium m...
WP_010886909 595 --------------EDVRDIVWLRFDGAEMSDEDWNNPqTQSLGMFlagdgL--A-----DVDAEGkpl---tdDHLLLL 650 Deinococcus rad...
WP_011030259 669 --------------DGLRDLAWFTAGGTEMTERDWYAP-AATLGMY-----L--SgrdipGRDEHGdpv---vdDSFLAV 723 Streptomyces co...
Q8KR69       575 --------------DVRW----LNAQGEALTPYEWEQG-THQLQIQ-----L--S-------------------ERWLLL 609 Erwinia chrysan...
WP_010973544 565 -----------------GDVTWLAPGGEPMTVADWERPdGQAFAMV-----L--S-------TPDRetg---kaTELAVL 610 Agrobacterium f...
BAC52034     590 --------------GLSYGALWLTPAGEEMTENDWKFPeGRFLSYV-----M--G-----PMEPGG--------AAIFIV 635 Bradyrhizobium ...
2VNC_A       663 LNANPNNVKVKFP--KG----K--WELVISSYL-R---EikP---E-ERIIEg---EKELEIEGRTALVYRR 715 Sulfolobus solfataricus...
CAE33357     647 CNAAAEPRPCVLP--APt--lA--WTLALDSAS-P---E--A---P-AAPCD----GGEAIVGARAVLLLTA 698 Bordetella bronchisepti...
AAM81590     663 LNANPNNVKVKFP--KG----K--WELVVGSYLrE---I--K---PeERIVDg---EKELEIEGRTALVYRR 715 Sulfolobus shibatae B12
P45178       614 INAKAEGQMFHLP--NR----K--WKPQ--IGT--------------HNVTLe---AQQAELSSMGFCMLND 658 Haemophilus influenzae ...
WP_010954850 657 VNAHHDIVPFKLP--AVp--eGdyWSCLVDTDR-P---El-R---K-GQHLQf---DSTFEVKGRSMLLMVl 712 Pseudomonas putida
WP_000210601 637 FNPFEGSVPFRIP--MWge-gG--WVLELTTAD-N---A--Q---Q-GMRITe---EMDFDLAGRSIVLFRR 690 Salmonella enterica
WP_011071679 685 VNADEHPLAFTPP--VFehlgP--WQCLLHTQT-E---P--QyltP-TEPLDaqssPTRYLLQDRSLMLFHA 745 Shewanella oneidensis
WP_010976095 641 NAGGDCEIALPHG--NGs--rR--WLRVLDTAA-D---E--P---F-GMRAS----ADRDTIPAQSVVAFVP 692 Sinorhizobium meliloti
WP_010886909 651 LSSSYVDLPFKMPdlGGc--gE--WDLLLDTSD-D---G--A---E-E-KVAa---GGETTLRGRSVKLYRC 704 Deinococcus radiodurans
WP_011030259 724 LHAGGEPAGFVLP--GApwaeR--YEVVVDTGQ-EeqgE--A---P-GTAHPa---GAEITVPARTVLLLRA 781 Streptomyces coelicolor
Q8KR69       610 VNATPQVSDFSLP--EG----E--WRVAPPFSA--------------TDHLLd---GQTWRGQANAVCVLVK 656 Erwinia chrysanthemi
WP_010973544 611 INRGRDIVPFTLP--GDg--wR-------------------------SIGTDf---GNPAFLPARSVVFYLR 650 Agrobacterium fabrum
BAC52034     636 LNAAPEEIAFKLP--KMteykS--WQQILNTTD-A---K--L---N-TIDFQp---GSDSKAPPRSVLAFAG 690 Bradyrhizobium diazoeff...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap