2IX0


Conserved Protein Domain Family
RNase_B

?
TIGR02062: RNase_B 
Click on image for an interactive view with Cn3D
exoribonuclease II
This family consists of exoribonuclease II, the product of the rnb gene, as found in a number of gamma proteobacteria. In Escherichia coli, it is one of eight different exoribonucleases. It is involved in mRNA degradation and tRNA precursor end processing. [Transcription, Degradation of RNA]
Statistics
?
PSSM-Id: 131117
View PSSM: TIGR02062
Aligned: 5 rows
Threshold Bit Score: 1158.43
Threshold Setting Gi: 25091171
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IX0_A  23 DDPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVEPFL 102 Escherichia coli
P30850   4 DNPLLAQLKQQLHSQTPRAEGVVKATEKGFGFLEVDAQKSYFIPPPQMKKVMHGDRIIAVIHSEKERESAEPEELVEPFL 83  Escherichia coli K-12
Q8K9Q5   4 NNPLLAQLKKNLHAKTPRVEGIVKSTERGFGFLEVDAQKSYFIPPKNMKNVMHGDKISAVLKIEKDREIAEPEKLIEPFL 83  Buchnera aphidicola s...
P44440   4 DNPLLAQLKQQIHDSKEQVEGVVKSTDKAYGFLECD-KKTYFIAPPSMKKVMHGDKIKATIEKQGDKEQAEPEALIEPML 82  Haemophilus influenza...
Q9KLE1   4 DNPLLAQLKQKIQETLPKKEGTIKASDKGFGFLEVDSKTSYFVPPPYMKKCMHGDKVVAFIRTENEREVAEPSELIEQSL 83  Vibrio cholerae O1 bi...
2IX0_A 103 TRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVP 179 Escherichia coli
P30850  84 TRFVGKVQG-KNDRLAIVPDHPLLKDA-IPCRAARGLNH-EFKEGDWAVAEMRRHPLKGDRSFYAELTQYITFGDDHFVP 160 Escherichia coli K-12
Q8K9Q5  84 NRFVGKIEK-KDNKLFIFPDYPFLKDF-IACRPKKSCVH-VFQTGDWAVAKLIQHKLNGNHIFYAELIEEIVKANNPLIP 160 Buchnera aphidicola s...
P44440  83 TRFIAKVRFnKDKKLQVLVDHPSINQP-IGAQQAKSVKE-ELQEGDWVVANLKTHPLRDDRFFYATINQLICRADDELAP 160 Haemophilus influenza...
Q9KLE1  84 TRFIGRVKL-FKGKLNVAPDHPQLKKLsLKAKTKKGLNEaDFQEGDWVVAHLVRHPLKGDDGFFVQISHKITDANDKIAP 162 Vibrio cholerae O1 bi...
2IX0_A 180 WWVTLARHNLEKEAPDGVATEMLDEGLV--REDLTALDFVTIDSASTEDMDDALFAKALPD----DKLQLIVAIADPTAW 253 Escherichia coli
P30850 161 WWVTLARHNLEKEAPDGVATEMLDEGLV--REDLTALDFVTIDSASTEDMDDALFAKALPD----DKLQLIVAIADPTAW 234 Escherichia coli K-12
Q8K9Q5 161 WWVTLSRHNLERKEPKIEKDDLILKNNSh-REDLTHLNFITIDNFNTKDIDDALFIEEIHN----GNLRLIVAIADPTSY 235 Buchnera aphidicola s...
P44440 161 WWVTLARHEQSRYPVRGAEPYEMLDQKT--RENLTALHFVTIDSESTMDMDDALYIEPIAQnstqTGWKLVVAIADPTAY 238 Haemophilus influenza...
Q9KLE1 163 WWVTLAENDLPNSEPAGIDDWQLKDDADlvREDLTALPFVTIDGESTKDMDDALYAQQLPN----GDFALTIAIADPTAY 238 Vibrio cholerae O1 bi...
2IX0_A 254 IAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKLVYD 333 Escherichia coli
P30850 235 IAEGSKLDKAAKIRAFTNYLPGFNIPMLPRELSDDLCSLRANEVRPVLACRMTLSADGTIEDNIEFFAATIESKAKLVYD 314 Escherichia coli K-12
Q8K9Q5 236 IKSGSKLDITAAKRGFTNYLPGFNVPMLPRSLSEDICSLNPHERRPVLACCITILKDGNICSKINFFLAWIKSKSKLSYD 315 Buchnera aphidicola s...
P44440 239 IALDSQIEQEAKQRCFTNYLPGFNIPMLPRELSDELCSLIANETRPALVCYIETDLTGNITAKPHFVSAYVQSKAKLAYN 318 Haemophilus influenza...
Q9KLE1 239 ITPEDEMDKVARERGFTIYLPGRNIPMLPRDLADELCSLMENQVRPALCCSVTIRKDGVIGDDIRFFAANIKSHARLVYD 318 Vibrio cholerae O1 bi...
2IX0_A 334 QVSDWLENTG--DWQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIVEEA 411 Escherichia coli
P30850 315 QVSDWLENTG--DWQPeSEAIAEQVRLLAQICQRRGEWRHNHALVFKDRPDYRFILGEKGEVLDIVAEPRRIANRIVEEA 392 Escherichia coli K-12
Q8K9Q5 316 NVSDWIEKKS--SWKPeTKSIENQILLLHRLCLLRIKWRTSNAVLFQDSLEYRFQFSETGIVEDVVIEKRRIAHKIIEES 393 Buchnera aphidicola s...
P44440 319 KVSDYLEQADn-AWQPeMPETAQQIHWLHQFTKARIQWRKTHSLFFKEKPDYAFVLAENGKVQEIKAEYRRIANQIVEEA 397 Haemophilus influenza...
Q9KLE1 319 HVSDWLETGSseQWQP-SEEIAQVVRDLYAFSQARANWRETHAVVFPDRPDYRFELSADNDVVAIHADMRRTANRLVEES 397 Vibrio cholerae O1 bi...
2IX0_A 412 MIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHG----------LHVDAEEVLTLDGFCKLRRELDAQPTG 481 Escherichia coli
P30850 393 MIAANICAARVLRDKLGFGIYNVHMGFDPANADALAALLKTHG----------LHVDAEEVLTLDGFCKLRRELDAQPTG 462 Escherichia coli K-12
Q8K9Q5 394 MIIANISAANFLSKNLGFGIYNTHAGFDPINAENVVSFLNNYN----------LKFTVKEITTLKGFCNLRRVLNILSDN 463 Buchnera aphidicola s...
P44440 398 MIIANICAAQFLHEQAKTGIFNTHSGFDKKFLENAHNFLMANLaneqnqtelaERYSVENLATLNGYCQMRHDIEPIESD 477 Haemophilus influenza...
Q9KLE1 398 MITANICAGKTLQTTFGFGVFNTHAGFKAEKMADVVELMAVNGa---------PNADAETLATVEGFAALRRWLATQETS 468 Vibrio cholerae O1 bi...
2IX0_A 482 FLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLNRMA 560 Escherichia coli
P30850 463 FLDSRIRRFQSFAEISTEPGPHFGLGLEAYATWTSPIRKYGDMINHRLLKAVIKGETATR-PQDEITVQMAERRRLNRMA 541 Escherichia coli K-12
Q8K9Q5 464 YINSRIRRYQSFGDFSITPSPHFALGLVEYATWTSPIRKYSDMINHRLLKSIINQDTNITkPSEDIKLKISEQKRRNRIA 543 Buchnera aphidicola s...
P44440 478 YLELRLRRYLTFAEFKSELAPHFGLGLEGYATWTSPIRKYSDMVNHRLIKAVLAKQPYEK-PQNDVLARLQEARRQNRLV 556 Haemophilus influenza...
Q9KLE1 469 YLDNRIRKYQSYSEIGNQPLPHFAMGLDVYATWTSPIRKYGDMINHRLLKAHILGKAPVQtPDETVGEELALHRKHHKIA 548 Vibrio cholerae O1 bi...
2IX0_A 561 ERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVYKVT 640 Escherichia coli
P30850 542 ERDVGDWLYARFLKDKAGTDTRFAAEIVDISRGGMRVRLVDNGAIAFIPAPFLHAVRDELVCSQENGTVQIKGETVYKVT 621 Escherichia coli K-12
Q8K9Q5 544 ERDISDWLYTLLLQKKEFKNKKFNAEIIDVSRSGIRAKLLENGANVFIPALFLHPIREELVFNQETGKVFIKGVLYYKIS 623 Buchnera aphidicola s...
P44440 557 ERDIADWLYCRYLADKVASNAEFEAEVQDVMRAGLRVQLLENGASLFIPAATLHNNKEEIQLNPDELALYIKGERTYKIG 636 Haemophilus influenza...
Q9KLE1 549 ERNVADWLYARTLADEPAKETRFQAEIFDINRPGMRVRLLENGAMAFIPGALILDNKERIECNGEDGTVLIDKEVVYKLG 628 Vibrio cholerae O1 bi...
2IX0_A 641 DVIDVTIAEVRMETRSIIARP 661 Escherichia coli
P30850 622 DVIDVTIAEVRMETRSIIARP 642 Escherichia coli K-12
Q8K9Q5 624 DLITVVLSEIRLQTRSIIARI 644 Buchnera aphidicola str. Sg (Schizaphis graminum)
P44440 637 DMVKVKLTEVKEATRSIVGEI 657 Haemophilus influenzae Rd KW20
Q9KLE1 629 DVLEIVLTEVNQENRSLVGKP 649 Vibrio cholerae O1 biovar El Tor str. N16961
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap