Conserved Protein Domain Family
AcsF

?
TIGR02029: AcsF 
magnesium-protoporphyrin IX monomethyl ester aerobic oxidative cyclase
This model respresents the oxidative cyclase responsible for forming the distinctive E-ring of the chlorin ring system under aerobic conditions. This enzyme is believed to utilize a binuclear iron center and molecular oxygen. There are two isoforms of this enzyme in some plants and cyanobacterai which are differentially regulated based on the levels of copper and oxygen. This step is essential in the biosynthesis of both bacteriochlorophyll and chlorophyll under aerobic conditions (a separate enzyme, BchE, acts under anaerobic conditions). This enzyme is found in plants, cyanobacteria and other photosynthetic bacteria. [Biosynthesis of cofactors, prosthetic groups, and carriers, Chlorophyll and bacteriochlorphyll]
Statistics
?
PSSM-Id: 131084
View PSSM: TIGR02029
Aligned: 4 rows
Threshold Bit Score: 575.981
Threshold Setting Gi: 6911864
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAB72164      54 KKGTKKEIQESLLTPRFYTTDFEEMEQlfnteINKNLNEAEFEALLQEFKTDYNQTHFVRNKEFKEAADK-LQGPLRQIF 132 thale cress
AAL76380       8 NESTQQALENRLLAPKFYRTDYKAMNT-----LDVSPVRREWDVMMANFEEDKNRAHFKQSIEFDPESLD-VDMDLKRDF 81  uncultured mari...
AAM48671      30 EKATEVAMQNTLLTPRFYTTDFAEMDA-----IDVTPVREDWDRLIAQMKSDPNKGHFKKNEDWDNVDWEgMEPALKAEF 104 uncultured mari...
WP_010995530   7 KPGIKTPSKETVLTPRFYTTDFETAAN-----LDLSAQENELQAMLAEMRADYNRHHFVRDEAFEQSWEH-IDGEARQAF 80  Nostoc sp. PCC ...
CAB72164     133 VEFLERSCTAEFSGFLLYKELGRRLKKTNpvVAEIFSLMSRDEARHAGFLNKGLSDFNLALDLGFLTKARKYTFFKPKFI 212 thale cress
AAL76380      82 LDFLVSSITSEYSGCVLYQEIEKNVDNPD--VSKLMRYMARDESRHAGFINRALKQLGVAVDLSVLKQTKEYHYFRPKFI 159 uncultured mari...
AAM48671     105 IDFLISSCTAEFSGCVLYKEMKRRGSNED--ITTLFQLMARDEARHAGFINDALREAGVRVNLGFLTQQKKYTYFRPKFI 182 uncultured mari...
WP_010995530  81 IEYLERSCISEFSGFLLFKELSRKLKNRSpvLAEMFQLMARDEARHAGFLNKAMGDFKLSLDLATVTKTRTYTFFPIEWV 160 Nostoc sp. PCC ...
CAB72164     213 FYATYLSEKIGYWRYITIYRHLKENPEFQCYPIFKYFENWCQDENRHGDFFSALMKAQPQFLNdWq-AKLWSRFFCLSVY 291 thale cress
AAL76380     160 YYATYLSEKIGYARYITIYRHLQRNPQNQFHPIFNWFERWCNDEYAHGEAFALLMRSDPKLLR-Gh-NKLWIRFFLLAVY 237 uncultured mari...
AAM48671     183 YYATYLSEKIGYARYITIYRHLEENPELRFHPIFKWFREWCNDEFSHGEAFALLMKSDPKLTE-SfgNKLWIKFFLTAVY 261 uncultured mari...
WP_010995530 161 LYTVYLSEKIGYWRYIIIFRHLEKHPENQFYPIFRYFESWCQDENRHGDIFKALLRSQPQLWNnWk-ARLWSRFFLLSVF 239 Nostoc sp. PCC ...
CAB72164     292 VTMYLNDCQRTNFYEGIGLNTKEFDMHVIIETNRTTARIFPAVLDVENPEFKRKLDRMVVSYEKLLAIGETDDasFIKTL 371 thale cress
AAL76380     238 STMYVRDHSRPKLYQAFGMDPTKFDYQVFDITSEISQQVFPMTLNTDDPRFRRGMERLLFLSEKAEGLRAKGG--LINKC 315 uncultured mari...
AAM48671     262 STMWVRDHQRPLFHEALGVDVTWYGQEVFRKTSEISKQIFPMTLDIDHPRWRKNLDRMEAASRQIAAAKARGG--LGGMI 339 uncultured mari...
WP_010995530 240 ATHTLTVHERSGFYKSLGLDATDFDLQVVRNTNETAGRAFPVMLNTEHPKFFPLLQRCAGYNLNISEIERSSQpkFVKLI 319 Nostoc sp. PCC ...
CAB72164     372 KRIPLVTSLASEILAAYLMPPVES 395 thale cress
AAL76380     316 LRLGVMAQSGLTFARLYCLPTKPN 339 uncultured marine proteobacterium
AAM48671     340 SRLGGMAKAATAFVLVFTIPAKTH 363 uncultured marine proteobacterium
WP_010995530 320 RKLPLIAAIVWNLLMVYLIKPIDT 343 Nostoc sp. PCC 7120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap