1BMD,7MDH


Conserved Protein Domain Family
MalateDH-SF1

?
TIGR01759: MalateDH-SF1 
Click on image for an interactive view with Cn3D
malate dehydrogenase
This model represents a family of malate dehydrogenases in bacteria and eukaryotes which utilize either NAD or NADP depending on the species and context. MDH interconverts malate and oxaloacetate and is a part of the citric acid cycle as well as the C4 cycle in certain photosynthetic organisms.
Statistics
?
PSSM-Id: 130820
View PSSM: TIGR01759
Aligned: 13 rows
Threshold Bit Score: 506.866
Threshold Setting Gi: 499324587
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BMD_A              2 KAPVRVAVTGAAGQIGYSLLFRIAAGEMLGkDQPVILQLLEIPQAMKALEGVVMELEDCAFPLLAGLEATDDPDVAFKDA 81  Thermus th...
AAC46986            1 MEPIHILITGAAGQIGYALTFRIAKGDLCG-DRKVVLHLLEIPFGMKALEGCVMELQDCAFPNVAGIVWTDKVEEAFKGV 79  Trichomona...
Q04820              2 PGPLRVLITGAAGQIAYNLSNMVANGNLFGkDQQIILHLLDIPEAKTVLDGVVMELQDCAFTVLAGIVPTHCLKEAFTDI 81  Echinococc...
FlyBase:CG5362-PA   2 AEPIRVVVTGAAGQIAYSLLYMIARGEVFGkDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEVVPTTDPAVGFKDV 81  fruit fly
AAM65532            3 KKPVRVLVTGAAGQIGYALVPMIARGIMLGaDQPVILHMLDIPFAAEALNGVKMELVDAAFPLLKGVVATTDAVEACTGV 82  thale cress
AAF36775            5 GACAKVVVSGAAGQVGYALLPLIAGGRMLGpNQHLQLNLLDIEPAMKCLEGIRAELMDCAFPLLDRVVITHKPAVAFENV 84  Trypanosom...
AAD44473            3 KPVLRVCISGAAGQICYSVLFRIAAGDMLGyDQPVHIVMLEVPAALKAAEGVAMELVDCAFPLLSGFTLTSDNAEAFKDV 82  Giardia in...
P17606             84 KKLVNIAVSGAAGMISNHLLFKLASGEVFGqDQPIALKLLGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDV 163 sorghum
AAD09994            2 SDPAHVLITGAAGQIGYILSHWIAGGELYG-DRPVVLHLFDIPPAMNRLTALTMELEDCAFPHLAGYVATTEPEAAFKDI 80  Trichomona...
7MDH_A             30 KKLVNIAVSGAAGMISNHLLFKLASGEVFGqDQPIALKLLGSERSFQALEGVAMELEDSLYPLLREVSIGIDPYEVFEDV 109 sorghum
WP_011712492        2 ADPIRVAVTGAAGQIAYSLLVRLASGQLFGkDRKVELKLLEIPQAMGPLEGVMMELQDCAFPTLAKVEAFDNPEQAFDGI 81  Magnetococ...
WP_010231127        3 SQTVSVAVTGGTGQIAYCFLFALAHGDIFGpDTGIDLRIYDIPGTERSLSGVRMELDDGAFPLLQRVQVTTSLHDAFDDI 82  Chlamydia ...
WP_011015079        7 vSTKKVTVTGAAGQISYSLLWRIANGEVFGtDTPVELKLLEIPQALGGAEGVAMELLDSAFPLLRNITITADANEAFDGA 86  Corynebact...
1BMD_A             82 DYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVAKKDVKVLVVGNPANTNALIAYKNAp-GLNPRNFTAMTRLDH 160 Thermus th...
AAC46986           80 DVAFLVGSFPRKDGMDRSDLLAKNGGIFTVQGKALNDYAKPTVKVLVVGNPANTNCLIAQASAp-KLQNKNWCAMTRLDH 158 Trichomona...
Q04820             82 DVALMVGAMPRKQGMERRDLLSSNVKIFKEQGEALDKYAKKTVKVLVVGNPANTNCLIMSKYAp-SIPKENFTALTRLDH 160 Echinococc...
FlyBase:CG5362-PA  82 SAAFLVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVLVVGNPANTNALVCSSYAp-SIPRENFSAMTRLDQ 160 fruit fly
AAM65532           83 NVAVMVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAPNCKVLVVANPANTNALILKEFAp-SIPEKNITCLTRLDH 161 thale cress
AAF36775           85 DIAILCGSFPAKPGTLRRDLLQKNAAIFSEHGRLLGELASKDCHVCVVGNPVNTNALVLLNASngKIKPKNVSALTRLDH 164 Trypanosom...
AAD44473           83 DYCLLFGAFPRKAGMERAELLSKNKGIFQIQGAAINEHAKPTCRILVIGNPANTNALVLSTQLt-KIPKTNVTAMSRLDH 161 Giardia in...
P17606            164 DWALLIGAKPRGPGMERAALLDINGQIFADQGKALNAVASKNVKVLVVGNPCNTNALICLKNAp-DIPAKNFHALTRLDE 242 sorghum
AAD09994           81 DCAFLVASMPLKPGQVRADLISSNSVIFKNTGEYLSKWAKPTVKVLVTGNPDNTNCEIAMLHAk-NLKPENFSFLSMLDH 159 Trichomona...
7MDH_A            110 DWALLIGAKPRGPGMERAALLDINGQIFADQGKALNAVASKNVKVLVVGNPCNTNALICLKNAp-DIPAKNFHALTRLDE 188 sorghum
WP_011712492       82 NWCLMVGSRPRGPGMERSDLIKINGPIFVNQGKALNRAAQ-DVRAVVVGNPCNTNCMIAAHNS--DVPHERFSAMMRLDQ 158 Magnetococ...
WP_010231127       83 DAAFLIGSVPRGPGMERRDLLKKNGEIFATQGKVLNTAAKREAKIFVVGNPVNTNCWIAMNHAp-RLLRKNFHAMLRLDQ 161 Chlamydia ...
WP_011015079       87 NAAFLVGAKPRGKGEERADLLANNGKIFGPQGKAINDNAADDIRVLVVGNPANTNALIASAAAp-DVPASRFNAMMRLDH 165 Corynebact...
1BMD_A            161 NRAKAQLAKKTGTGVDRIRRMTVWGNHSSTMFPDLFHAEVD------GRPALELV-DMeWYEKVFIPTVAQRGAAIIQAR 233 Thermus th...
AAC46986          159 NRMVGALAAKFGVTPEKIHKVCIWGNHSNTQVPDTTHATVDlp--egTVKVADKLpKE-YLEGEFAQMIATRGGAVIKMR 235 Trichomona...
Q04820            161 NRAIYQVAAKAGVPNTCVKNVCIWGNHSNKQFPDLSHAVVTkd--gkQHPAKELInDEkWVKEVFIPCVQNRGAAVIGLR 238 Echinococc...
FlyBase:CG5362-PA 161 NRATSQIAAKLGVPISAVKNIIIWGNHSSTQYPDAGQAKVTan--gtVKSVVDAInDNgYLQGSFVETVQKRGAAVIAAR 238 fruit fly
AAM65532          162 NRALGQVSERLSVPVSDVKNVIIWGNHSSTQYPDVNHATVKts--sgEKPVRELVkNDeWLNGEFISTVQQRGAAIIKAR 239 thale cress
AAF36775          165 NRSLALVAERANAHVRDVKNCIIWGNHSGTQVPDVNSATVR------GVPVREAIkDDaYFDGEFMTTVQQRGYEIIRWR 238 Trypanosom...
AAD44473          162 NRAVGQVAGKLGVRTNRISNVWVAGNHSNTMVPIVDCGVIYdeglkdKQPVKPMLpAD-WIKGEFVPCVRGRGTAVIEAR 240 Giardia in...
P17606            243 NRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKID------GRPVKEVIkDTkWLEEEFTITVQKRGGALIQKW 316 sorghum
AAD09994          160 NRAYYEVASKLGVHVHDVHDIIVWGNHGESMVADLTQATFTkd--gkTQKVVDVLdHD-YVFGTFFKKIGHRAWDILEHR 236 Trichomona...
7MDH_A            189 NRAKCQLALKAGVFYDKVSNVTIWGNHSTTQVPDFLNAKID------GRPVKEVIkRTkWLEEEFTITVQKRGGALIQKW 262 sorghum
WP_011712492      159 NRAKYLLASKAGAQVIDVTNVVIWGNHSNNQVPDFEFAKIG------GKPVPEVIaDAaWLENAFMPTVQNRGAAVIKAR 232 Magnetococ...
WP_010231127      162 NRMHSMLAHRAEVPLSAVSQVVVWGNHSAKQVPDFTQALIH------GRPIVETIaDRdWLENIMVPSVQSRGSAVIEAR 235 Chlamydia ...
WP_011015079      166 NRAISQLATKLGRGSAEFNNIVVWGNHSATQFPDITYATVG------GEKVTDLV-DHdWYVEEFIPRVANRGAEIIEVR 238 Corynebact...
1BMD_A            234 GASSAASAANAAIEHIRDWALGTPEGDWVSMAVPS-QG-EYGIPEGIVYSFPVTAK-DGAYRVVEGLEINEFARKRMEIT 310 Thermus th...
AAC46986          236 GASSAASAANAALTCVKDWLYGTAEGDFVSMAIPVpDNePYGIKQGTIFSFPVTVSkDGEVHVVEGLELNDWVKGRLEAT 315 Trichomona...
Q04820            239 KLSRAASAAKAIVDQMRDWWFGTKEGEWVSMSVYS-TGdHYGAPKDIYFSFPVTIK-DGHYKVVDGLSMDEWSRSLFNLS 316 Echinococc...
FlyBase:CG5362-PA 239 KMSSAMSAAKAACDHMHDWWNGTAPGQFVSMGVFS-DG-SYDSPKDVIFSFPVEIK-NKQWKIVSGLTLSDFAKTKLSVT 315 fruit fly
AAM65532          240 KLSSALSAASSACDHIRDWVVGTPEGTFVSMGVYS-DG-SYNVPAGLIYSFPVTCR-NGEWTIVQGLPIDDASRKKMDLT 316 thale cress
AAF36775          239 GNSSALSAANAAVDQVHDWVLGTPTGTHVSMAVYS-DGnPYGVPPGLVFSFPVTCS-GGEWQFVENACVTPSVAKHLAAT 316 Trypanosom...
AAD44473          241 GHSSSASAANAAIDHVRDWHMGTKPGAFVSCSLLIeEGnPYGIAPGIFYSMPCSCv-GGKWQIVK-LDLPKDVLDEMKLS 318 Giardia in...
P17606            317 GRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYT-TGnPYGIAEDIVFSMPCRSKgDGDYELATDVSMDDFLWERIKKS 395 sorghum
AAD09994          237 GFTSAASPTKAAIQHMKAWLFGTAPGEVLSMGIPVpEDnPYGIKPGVVFSFPCNVDkEGKIHVVDGFKVNDWLREKLDFT 316 Trichomona...
7MDH_A            263 GRSSAASTAVSIADAIKSLVTPTPEGDWFSTGVYT-TGnPYGIAEDIVFSMPCRSKgDGDYELATDVSNDDFLWERIKKS 341 sorghum
WP_011712492      233 GASSAASAANAALDHVRSLITPTPAGDTFCAAVMA-NG-AYGVDAGLIAGMPLTSTgHGDWSIVEGVPMSPFIKGKFDAV 310 Magnetococ...
WP_010231127      236 GKSSAASAARALAEAARSIYQP-KEGEWFSSGVCS-DNnPYGLPEDIIFGFPCRMLgTGEYEIVPGLPWDAFIRGKMQIS 313 Chlamydia ...
WP_011015079      239 GKSSAASAASSAIDHMRDWVQGT--EAWSSAAIPS-TG-AYGIPEGIFVGLP-TVSrNGEWEIVEGLEISDFQRARIDAN 313 Corynebact...
1BMD_A            311 AQELLDEMEQV 321 Thermus thermophilus
AAC46986          316 EKELIGEKETA 326 Trichomonas vaginalis
Q04820            317 ADELVDEREVA 327 Echinococcus granulosus
FlyBase:CG5362-PA 316 GKELQEEKDEA 326 fruit fly
AAM65532          317 AEELKEEKDLA 327 thale cress
AAF36775          317 TKELEEERSES 327 Trypanosoma cruzi
AAD44473          319 EAELMKEAADA 329 Giardia intestinalis
P17606            396 EAELLAEKKCV 406 sorghum
AAD09994          317 MNDLFHEKEIA 327 Trichomonas vaginalis
7MDH_A            342 EAELLAEKKCV 352 sorghum
WP_011712492      311 LDELRREREMV 321 Magnetococcus marinus
WP_010231127      314 LDEILQEKASV 324 Chlamydia muridarum
WP_011015079      314 AQELQAEREAV 324 Corynebacterium glutamicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap