Conserved Protein Domain Family
MDH_euk_cyt

?
TIGR01758: MDH_euk_cyt 
malate dehydrogenase, NAD-dependent
This model represents the NAD-dependent cytosolic malate dehydrogenase from eukaryotes. The enzyme from pig has been studied by X-ray crystallography
Statistics
?
PSSM-Id: 130819
View PSSM: TIGR01758
Aligned: 4 rows
Threshold Bit Score: 543.284
Threshold Setting Gi: 7109727
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q04820              6 RVLITGAAGQIAYNLSNMVANGNLFGKDQQIILHLLDIPEAKTVLDGVVMELQDCAFTVLAGIVPTHCLKEAFTDIDVAL 85  Echinococc...
FlyBase:CG5362-PA   6 RVVVTGAAGQIAYSLLYMIARGEVFGKDQPIVLHLLDIPPMVGVLEGVVMELADCALPLLVEVVPTTDPAVGFKDVSAAF 85  fruit fly
AAM65532            7 RVLVTGAAGQIGYALVPMIARGIMLGADQPVILHMLDIPFAAEALNGVKMELVDAAFPLLKGVVATTDAVEACTGVNVAV 86  thale cress
AAF36775            9 KVVVSGAAGQVGYALLPLIAGGRMLGPNQHLQLNLLDIEPAMKCLEGIRAELMDCAFPLLDRVVITHKPAVAFENVDIAI 88  Trypanosom...
Q04820             86 MVGAMPRKQGMERRDLLSSNVKIFKEQGEALDKYAKKTVKVLVVGNPANTNCLIMSKYAPS-IPKENFTALTRLDHNRAI 164 Echinococc...
FlyBase:CG5362-PA  86 LVGAMPRKEGMERKDLLSANVKIFRTQGQALDKFAKKDVKVLVVGNPANTNALVCSSYAPS-IPRENFSAMTRLDQNRAT 164 fruit fly
AAM65532           87 MVGGFPRKEGMERKDVMSKNVSIYKSQASALEKHAAPNCKVLVVANPANTNALILKEFAPS-IPEKNITCLTRLDHNRAL 165 thale cress
AAF36775           89 LCGSFPAKPGTLRRDLLQKNAAIFSEHGRLLGELASKDCHVCVVGNPVNTNALVLLNASNGkIKPKNVSALTRLDHNRSL 168 Trypanosom...
Q04820            165 YQVAAKAGVPNTCVKNVCIWGNHSNKQFPDLSHAVVTKDGKQHPAKELINDEKWVKEVFIPCVQNRGAAVIGLRKLSRAA 244 Echinococc...
FlyBase:CG5362-PA 165 SQIAAKLGVPISAVKNIIIWGNHSSTQYPDAGQAKVTANGTVKSVVDAINDNGYLQGSFVETVQKRGAAVIAARKMSSAM 244 fruit fly
AAM65532          166 GQVSERLSVPVSDVKNVIIWGNHSSTQYPDVNHATVKTSSGEKPVRELVKNDEWLNGEFISTVQQRGAAIIKARKLSSAL 245 thale cress
AAF36775          169 ALVAERANAHVRDVKNCIIWGNHSGTQVPDVNSATVR-G---VPVREAIKDDAYFDGEFMTTVQQRGYEIIRWRGNSSAL 244 Trypanosom...
Q04820            245 SAAKAIVDQMRDWWFGTKEGEWVSMSVYSTGDhYGAPKDIYFSFPVTIKDGHYKVVDGLSMDEWSRSLFNLSADELVDER 324 Echinococc...
FlyBase:CG5362-PA 245 SAAKAACDHMHDWWNGTAPGQFVSMGVFSDGS-YDSPKDVIFSFPVEIKNKQWKIVSGLTLSDFAKTKLSVTGKELQEEK 323 fruit fly
AAM65532          246 SAASSACDHIRDWVVGTPEGTFVSMGVYSDGS-YNVPAGLIYSFPVTCRNGEWTIVQGLPIDDASRKKMDLTAEELKEEK 324 thale cress
AAF36775          245 SAANAAVDQVHDWVLGTPTGTHVSMAVYSDGNpYGVPPGLVFSFPVTCSGGEWQFVENACVTPSVAKHLAATTKELEEER 324 Trypanosom...
Q04820            325 EVALA 329 Echinococcus granulosus
FlyBase:CG5362-PA 324 DEALS 328 fruit fly
AAM65532          325 DLAYS 329 thale cress
AAF36775          325 SESLS 329 Trypanosoma cruzi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap