1K3F


Conserved Protein Domain Family
Uridine-psphlse

?
TIGR01718: Uridine-psphlse 
Click on image for an interactive view with Cn3D
uridine phosphorylase
This model represents a family of bacterial and archaeal uridine phosphorylases unrelated to the mammalian enzymes of the same name. The E. coli, Salmonella and Klebsiella genes have been characterized. Sequences from Clostridium, Streptomyces, Treponema, Halobacterium and Pyrobaculum were included above trusted on the basis of sequence homology and a PAM-based neighbor-joining tree. A clade including second sequences from Halobacterium and Vibrio was somewhat more distantly related and may represent a slightly different substrate specificity - these were placed below the noise cutoff. More distantly related is a clade of archaeal sequences which as related to the DeoD family of inosine phosphorylases (TIGR00107) as they are to these uridine phosphorylases. This clade includes a characterized protein from Sulfolobus solfataricus which has been mis-named as a methylthioadenosine phosphorylase, but which acts on inosine and guanosine - it is unclear whether uridine has been evaluated as a substrate. [Purines, pyrimidines, nucleosides, and nucleotides, Salvage of nucleosides and nucleotides]
Statistics
?
PSSM-Id: 130779
View PSSM: TIGR01718
Aligned: 4 rows
Threshold Bit Score: 397.343
Threshold Setting Gi: 18161392
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1K3F_A     6 VFHLGLTKNDLQgaTLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLG 85  Escherichia coli K-12
AAL64679  11 AYHLLLAQGEIP--RYVLLPGDPGRVPLIAKHWDEAREVARNREFVTYVGRYKGVSIGATSTGIGSGSTAIAVEELLYAG 88  Pyrobaculum aerophi...
O83990    10 EYHIGLKASDIG--HYVILPGDPARSEKIAQHFSHPHKVGHNREYVTYTGTLCETPVSVMSTGIGGPSTAIGVEELIHLG 87  Treponema pallidum ...
P12758     6 VFHLGLTKNDLQgaTLAIVPGDPDRVEKIAALMDKPVKLASHREFTTWRAELDGKPVIVCSTGIGGPSTSIAVEELAQLG 85  Escherichia coli K-12
1K3F_A    86 IRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPG 165 Escherichia coli K-12
AAL64679  89 ADTFIRVGTTGALWRHIKLGDLIIGAAAVRWDGASRWYAPPEYPAVAHWVVVNALVKAAESLGVRHHVGIVASTDSFYVG 168 Pyrobaculum aerophi...
O83990    88 AHTFIRVGTSGGMQPDILAGTVVIATGAIRFEGTSKEYAPVEFPAVPDFTVTAALKHAAEDVQVRHALGVVQCKDNFYGQ 167 Treponema pallidum ...
P12758    86 IRTFLRIGTTGAIQPHINVGDVLVTTASVRLDGASLHFAPLEFPAVADFECTTALVEAAKSIGATTHVGVTASSDTFYPG 165 Escherichia coli K-12
1K3F_A   166 QERyDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAEtmkqTESHAVKIV 245 Escherichia coli K-12
AAL64679 169 QER-PGHGGFLPPWAKGLIEALRGLMVLSFEMESATIFTLASIYGARAGGVYAVIANRETDEFAPEV----GVEEAIKVA 243 Pyrobaculum aerophi...
O83990   168 HSP-HTMP--VHAELTQKWHAWIACNTLASEMESAALFVLGSVRRVRTGAVLLVIGNQTRRAQGLEDiqvhDTENAIRVA 244 Treponema pallidum ...
P12758   166 QERyDTYSGRVVRHFKGSMEEWQAMGVMNYEMESATLLTMCASQGLRAGMVAGVIVNRTQQEIPNAEtmkqTESHAVKIV 245 Escherichia coli K-12
1K3F_A   246 VEAARRLL 253 Escherichia coli K-12
AAL64679 244 NEAVKILA 251 Pyrobaculum aerophilum str. IM2
O83990   245 VEAVKLLI 252 Treponema pallidum subsp. pallidum str. Nichols
P12758   246 VEAARRLL 253 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap