Conserved Protein Domain Family
pro_imino_pep_1

?
TIGR01249: pro_imino_pep_1 
proline iminopeptidase, Neisseria-type subfamily
This model represents one of two related families of proline iminopeptidase in the alpha/beta fold hydrolase family. The fine specificities of the various members, including both the range of short peptides from which proline can be removed and whether other amino acids such as alanine can be also removed, may vary among members.
Statistics
?
PSSM-Id: 130316
View PSSM: TIGR01249
Aligned: 4 rows
Threshold Bit Score: 542.891
Threshold Setting Gi: 1730580
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
TIGR:At2g14260  19 IEPYSSGNLKVSDVHTLYWEQSGKPDGHPVVFLHGGPGGGTAPSNRRFFDPEFYRIVLFDQRGAGKSTPHACLEENTTWD 98  thale cress
Q9JZR6           5 KQPFHSGYLQVSEIHQIYWEESGNPDGVPVIFLHGGPGAGASPECRGFFNPDVFRIVIIDQRGCGRSRPYACAEDNTTWD 84  Neisseria men...
P47266           3 TKLNVKGYLNVGDNHQLYYWTQGNPNGKPVLYIHGGPGSGTDEGCLKYFDLETTWIILLDQRGCGKSKTNDIFYENNTDK 82  Mycoplasma ge...
WP_010894011     8 VTPFEHGILCVDDNHRLYYEQCGNPHGKPVVILHGGPGSGCNDKMRRFHDPDKYRIVLFDQRGAGRSTPHANLTNNTTWD 87  Xylella fasti...
TIGR:At2g14260  99 LVNDIEKLREHLKIPEWLVFGGSWGSTLALAYSQSHPDKVTGLVLRGIFLLRKKEIDWFYEGG-AAAIYPDAWEEFRDLI 177 thale cress
Q9JZR6          85 LVADIEKVREMLGIGKWLVFGGSWGSTLSLAYAQTHPERVKGLVLRGIFLCRPSETVWLNEAGgVSRIYPEQWQKFVAPI 164 Neisseria men...
P47266          83 LVSDFEILRQKLNIKNWTLFGGSWGSALALVYAIKHPQVVDKIFLRALFLAREKDWSEALMGl-GKMFYPYEHQRFMDSI 161 Mycoplasma ge...
WP_010894011    88 LVADIEKLRVALGITRWQVFGGSWGSTLALAYAQTHPEQTTELVLRGIFMLRRWELEWFYQEG-ASHLFPDAWDRYIAVI 166 Xylella fasti...
TIGR:At2g14260 178 PENERg--SSLVDAYHKRLNSDDLEIQYAAARAWTKWEmmTAYLRPNLENVQkaEDDKFSLAFARIENHYFVNKGFFPSD 255 thale cress
Q9JZR6         165 AENRR---NRLIEAYHGLLFHQDEEVCLSAAKAWADWE--SYLIRFEPEEVD--EDAYASLAIARLENHYFVNGGWLQGD 237 Neisseria men...
P47266         162 PKAYQnsyEQIVNYCYDQFQNGDESTKEKLAKAWVDWEs--TLLSPINKIHStaTDFKLVEKLALLECHYAVNKSFLD-E 238 Mycoplasma ge...
WP_010894011   167 PPVER---HDLISAFHRRLTSEDEATRLAAAQAWSLWEgaTSCLYMDQDFIAshENPHFALAFARIENHYFVNGGFFEVE 243 Xylella fasti...
TIGR:At2g14260 256 SHLLDNVDKIRHIKTTIVQGRYDVCCPMMSAWDLHKAWPEAELKIVYdAGHSANEPGISAELVVANEKMK 325 thale cress
Q9JZR6         238 RAILNNIGKIRHIPTIIVQGRYDLCTPMQSAWALSKAFPEAELRVVQ-AGHRAFDPPLVDALVQAVEDIL 306 Neisseria meningitidis ...
P47266         239 NFILDNISVLKNKSIYLAHGRFDLICPLYQPLALKQAFPELQLYVTNnAGHSGSDANNLATIKHLLKTYL 308 Mycoplasma genitalium G37
WP_010894011   244 NQLLRDAQRIANIPGVIVHGRYDVVCPLQNAWDLHKVWPKASLKITPgAGHSAFEPQNIDALVCATDSFV 313 Xylella fastidiosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap