Conserved Protein Domain Family
ntrB

?
TIGR01183: ntrB 
nitrate ABC transporter, permease protein
This model describes the nitrate transport permease in bacteria. This is gene product of ntrB. The nitrate transport permease is the integral membrane component of the nitrate transport system and belongs to the ATP-binding cassette (ABC) superfamily. At least in photosynthetic bacteria nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA, ntrB, ntrC, ntrD, narB. Functionally ntrC and ntrD resemble the ATP binding components of the binding protein-dependent transport systems. Mutational studies have shown that ntrB and ntrC are mandatory for nitrate accumulation. Nitrate reductase is encoded by narB. [Transport and binding proteins, Anions]
Statistics
?
PSSM-Id: 130251
View PSSM: TIGR01183
Aligned: 4 rows
Threshold Bit Score: 312.118
Threshold Setting Gi: 585581
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P38044    66 IVEPFFDNGGTSKGLGLQILISLQRVAIGYLLAACTGILVGGVLGMSKFLGKGLDPVIQVLRTVPPLAWFPISLMVFQDA 145 Synechococcus elong...
P73451    64 ILNPFFDNGGTDKGLGIQIFASLTRVAVGFSAAAVVGIALGILIGSSKFMYDALDPIFQVLRTIPPLAWLPIALAALQEA 143 Synechocystis sp. P...
Q51881    68 IIDPFYRGSGTDQGLFWQIAASLQRVAVGYLMAAIAGIALGILIGVSVLMFQALDPIFQVLRTVPPLAWLPISLAAFRDS 147 Phormidium laminosum
BAA05387  68 LLYPFLDRGGLDKGLFWQTIASLTRVAQGFSIAAIIGISVGILVGLNRQLNAMLDPLFQFLRMIAPLAWVPIALVAFQQN 147 Synechococcus elong...
P38044   146 NTSAIFVIFITAIWPIIINTAVGINQIPDDYNNVARVLKLSKKDYILNILIPSTVPYVFAGLRIAVGLAWLAIVAAEMLK 225 Synechococcus elong...
P73451   144 EPSAIFVIFITAIWPIVINTTVGAQQVPQDYRNVSRVLKLSKSQYFFNILFPAAVPYIFTGLRIGIGLSWLAIVAAEMLI 223 Synechocystis sp. P...
Q51881   148 QPAAIFVIFITAIWPIIINTAVGVQNIPQDYNNVARVLKLSRLDYFLKVLLPATVPYIFTGLKIAIGLSWLAIVAAEMLT 227 Phormidium laminosum
BAA05387 148 QPAAIFVIFITAVWPILINTAEGVRQIPQDYNNVARVLRMSKSKYLMKVVLPAALPYIFTGLRIAIGLSWLAIIAAEIVM 227 Synechococcus elong...
P38044   226 AD-GGIGYFIWDAYNAGgdgSSSQIILAIFYVGLVGLSLDRLVAWV 270 Synechococcus elongatus PCC 7942
P73451   224 GG-VGIGFFIWDAYNSS---LISEIIIALIYVGIVGLLLDRFIAFL 265 Synechocystis sp. PCC 6803 substr. Kazusa
Q51881   228 GG-VGIGFFIWDAYNSG---SNSEVILAIIYVGLVGLLLNALVGFI 269 Phormidium laminosum
BAA05387 228 SGiVGIGFFIWDAYQQN---YVSDIILAVIYIGAVGLLLDRFVAWL 270 Synechococcus elongatus PCC 7942
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap