Conserved Protein Domain Family
lacA

?
TIGR01118: lacA 
galactose-6-phosphate isomerase, LacA subunit
This family contains members from low GC gram-positive bacteria. Galactose-6-phosphate isomerase is involved in lactose catabolism by the tagatose-6-phosphate pathway. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
Statistics
?
PSSM-Id: 130188
View PSSM: TIGR01118
Aligned: 3 rows
Threshold Bit Score: 242.926
Threshold Setting Gi: 125907
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P26594   1 MAIIIGSDEAGKRLKEVIKSYLLDNKYDVVDVTEGQEVDFVDATLAVAKDVQSQEGNLGIVIDAFGTGSFMVATKIKGMI 80  Staphylococcus aureus
P26423   1 MAIIIGSDAAGKRLKDVIKTFLKDNNHEVLDVTERKDLDFVDSTLAVVHEVQKNDKNLGIAIDAYGAGSFMVATKVKGMI 80  Streptococcus mutans ...
P23494   1 MAIVVGADLKGTRLKDVVKNFLVEEGFEVIDVTK-DGQDFVDVTLAVASEVNKDEQNLGIVIDAYGAGPFMVATKIKGMV 79  Lactococcus lactis su...
P26594  81 AAEVSDERSGYMTRGHNNSRMITMGSEIVGDTLAKNVVKGFVEGKYDGGRHQIRVDMLNKM 141 Staphylococcus aureus
P26423  81 AAEVSDERSAYMTRGHNNARIITLGAEIVGDELAKNIVKDFVEAKYDGGRHQIRVDMLNKM 141 Streptococcus mutans UA159
P23494  80 AAEVSDERSAYMTRGHNNARMITVGAEIVGDELAKNIAKAFVNGKYDGGRHQVRVDMLNKM 140 Lactococcus lactis subsp. lactis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap