
Conserved Protein Domain Family

TIGR01032: rplT_bact 
Click on image for an interactive view with Cn3D
ribosomal protein L20
This model describes bacterial ribosomal protein L20 and its chloroplast equvalent. This protein binds directly to 23s ribosomal RNA and is necessary for the in vitro assembly process of the 50s ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit. GO process changed accordingly (SS 5/09/03) [Protein synthesis, Ribosomal proteins: synthesis and modification]
PSSM-Id: 130104
Aligned: 13 rows
Threshold Bit Score: 135.585
Threshold Setting Gi: 491782491
Created: 8-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1VS6_Q        82 GLKKASVEIDRKILADIAVFDKVAFTALVEKAK 114  Salmonella enterica subsp. enterica serovar Typhi
P47440        81 ELKKAKIVINRKVLSELAIKEPNKLNLIINTIK 113  Mycoplasma genitalium G37
P48957        82 QLKKANIEINRKMLAQLAVLDPAAFSEVVKVAA 114  Synechocystis sp. PCC 6803 substr. Kazusa
Q9X1S8        81 GLKLAGVSINRKMLSELAVNDPEAFKEYVKIAK 113  Thermotoga maritima MSB8
Q9ZCV0        82 ALKKAGINIDRKVLAELAVNNNDGFASIVQQSK 114  Rickettsia prowazekii str. Madrid E
Q9ZMV1        81 ALKVANIELDRKVLADMAMNDMQAFKSVLESVK 113  Helicobacter pylori J99
O51206        82 GLLKSNIKINRKILSNLAIEDVEAFKKIVLEIR 114  Borrelia burgdorferi B31
O84842        82 GLKQAGIHLNRKMLSEMAIHDPQGFAVVATQAK 114  Chlamydia trachomatis D/UW-3/CX
Q9Z6R7        82 GLKCANISLNRKMLSEIAIHNPEGFAEIANQAK 114  Chlamydia pneumoniae
O83820        82 GLLQAGIALNRKVLSNMAIEDPGAFQTVIDASK 114  Treponema pallidum subsp. pallidum str. Nichols
P78023        81 LLKKHNIEINRKVLSELAIKEPSKFNLIVQKVK 113  Mycoplasma pneumoniae M129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap