1VS6


Conserved Protein Domain Family
rplT_bact

?
TIGR01032: rplT_bact 
Click on image for an interactive view with Cn3D
ribosomal protein L20
This model describes bacterial ribosomal protein L20 and its chloroplast equvalent. This protein binds directly to 23s ribosomal RNA and is necessary for the in vitro assembly process of the 50s ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit. GO process changed accordingly (SS 5/09/03) [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130104
View PSSM: TIGR01032
Aligned: 13 rows
Threshold Bit Score: 135.585
Threshold Setting Gi: 491782491
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VS6_Q         2 ARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGISYSKFIN 81   Salmonella ent...
P47440         1 MRVKGTNTTRIRRKKWLKQASGSFGTRKASFKAAKQTVIQASKYAYRDRRQKKREFRSLWILRLNAALRAQGMTYSVFIN 80   Mycoplasma gen...
P48957         2 TRVKRGNVARKRRKKILKLAKGFRGSHSKLFRTANQQVMKALRNAYRDRRKRKRDFRRLWITRINAAARQEGMSYSKLTG 81   Synechocystis ...
Q9X1S8         1 MRVKRAVHAKKKRKKYLKAAKGYRGALSRRYKLAKQMYVRSKWYSYVGRKQKKRDMRKLWITRINIAARNEGLKYSELIH 80   Thermotoga mar...
Q9ZCV0         2 TRAKSGKISKKRHKKILKLAKGYRGRANNCFRVAIEKVEKGLQYAYRDRRNRKRDFRGLWIQRINAAVREHGLIYSQFMG 81   Rickettsia pro...
Q9ZMV1         1 MRVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSMYYAFRDRKQKKREFRSLWVVRINAACRMHNTSYSRFMH 80   Helicobacter p...
O51206         2 ARAKNGTVHVARRKRILKKTKGFWGTKKSNYKKAKDTLXKGMMYATRDRKVRKRDFRRLWISRISAALSDTGVTYSRFIE 81   Borrelia burgd...
O84842         2 VRATGSVASRSRRKRVLKQAKGFWGDRKGHFRQSRSSVMRAMAFNYMHRKDRKGDFRSLWITRLSVASRIHGLSYSRLIN 81   Chlamydia trac...
Q9Z6R7         2 VRATGSVASRRRRKRILKQAKGFWGDRKGHIRQSRSSVMRAMAFNYMHRKDRKGDFRSLWIARLNVASRIHSLSYSRLIN 81   Chlamydia pneu...
O83820         2 SRSLSSNGRVRRRKRILKLAKGFRGRCGTNYKAAKDAVSKALAHSYVARRDRKGSMRRLWISRINASVRTQGLSYSRFMN 81   Treponema pall...
CDW60863     843 ARVKRGVIARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGISYSKFIN 922  human whipworm
WP_005596075   2 ARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQLWIARINAAARQNGLSYSKFIN 81   Pasteurellaceae
P78023         1 MRIKGGKQTRVRRKKWLKQASGSFGTRHASYKVAKQTVIQAAKYAYRDRRNKKRDFRSLWILRLNAALREQGMTYSVFIN 80   Mycoplasma pne...
1VS6_Q        82 GLKKASVEIDRKILADIAVFDKVAFTALVEKAK 114  Salmonella enterica subsp. enterica serovar Typhi
P47440        81 ELKKAKIVINRKVLSELAIKEPNKLNLIINTIK 113  Mycoplasma genitalium G37
P48957        82 QLKKANIEINRKMLAQLAVLDPAAFSEVVKVAA 114  Synechocystis sp. PCC 6803 substr. Kazusa
Q9X1S8        81 GLKLAGVSINRKMLSELAVNDPEAFKEYVKIAK 113  Thermotoga maritima MSB8
Q9ZCV0        82 ALKKAGINIDRKVLAELAVNNNDGFASIVQQSK 114  Rickettsia prowazekii str. Madrid E
Q9ZMV1        81 ALKVANIELDRKVLADMAMNDMQAFKSVLESVK 113  Helicobacter pylori J99
O51206        82 GLLKSNIKINRKILSNLAIEDVEAFKKIVLEIR 114  Borrelia burgdorferi B31
O84842        82 GLKQAGIHLNRKMLSEMAIHDPQGFAVVATQAK 114  Chlamydia trachomatis D/UW-3/CX
Q9Z6R7        82 GLKCANISLNRKMLSEIAIHNPEGFAEIANQAK 114  Chlamydia pneumoniae
O83820        82 GLLQAGIALNRKVLSNMAIEDPGAFQTVIDASK 114  Treponema pallidum subsp. pallidum str. Nichols
CDW60863     923 GLKKASVEIDRKILADIAVFDKVAFTALVEKAK 955  human whipworm
WP_005596075  82 GLKKASVEIDRKILADIAVFDKVAFAALVEKAK 114  Pasteurellaceae
P78023        81 LLKKHNIEINRKVLSELAIKEPSKFNLIVQKVK 113  Mycoplasma pneumoniae M129
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap