Conserved Protein Domain Family

TIGR01022: rpmJ_bact 
ribosomal protein L36, bacterial type
Proteins found by this model occur exclusively in bacteria and organelles. [Protein synthesis, Ribosomal proteins: synthesis and modification]
PSSM-Id: 130094
Aligned: 8 rows
Threshold Bit Score: 37.4636
Threshold Setting Gi: 7674319
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P47420        1 MKVRASVKPICKDCKIIKRHRILRVICKT-KKHKQRQG 37  Mycoplasma genitalium G37
O83239        1 MKIRTSVKVICDKCKLIKRFGIIRVICVN-PKHKQRQG 37  Treponema pallidum subsp. pallidum str. Nichols
P46361        1 MKVRASVKKMCRNCKIVKREGVVRVLCSD-PKHKQRQG 37  Haemophilus influenzae Rd KW20
P20278        1 MKVRPSVKPICEKCKVIRRKGKVMVICEN-PKHKQKQG 37  Bacillus subtilis subsp. subtilis str. 168
WP_010889757  3 MKVRVSVKPICEKCKVIKRKGVLRIICDN-LKHKQRQK 39  Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap