1P87


Conserved Protein Domain Family
rpsB_bact

?
TIGR01011: rpsB_bact 
Click on image for an interactive view with Cn3D
ribosomal protein S2, bacterial type
This model describes the bacterial, ribosomal, and chloroplast forms of ribosomal protein S2. TIGR01012 describes the archaeal and cytosolic forms. [Protein synthesis, Ribosomal proteins: synthesis and modification]
Statistics
?
PSSM-Id: 130084
View PSSM: TIGR01011
Aligned: 15 rows
Threshold Bit Score: 352.778
Threshold Setting Gi: 1350974
Created: 8-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1P87_B         2 TVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKD 81  Escherichia coli
O83615         3 VVTIKNLLESGVHFGHQVRRWDPRMKKYIFAERNGIHIIDLQKTITAIREAYDMVRRTVSSGKSVLFVGTKKQSQQTIAK 82  Treponema palli...
Q10796         3 VVTMKQLLDSGTHFGHQTRRWNPKMKRFIFTDRNGIYIIDLQQTLTFIDKAYEFVKETVAHGGSVLFVGTKKQAQESVAA 82  Mycobacterium t...
P74071         3 VVSLADLLESGVHFGHQTRRWNPRMDQYIYTARNGVHIIDLVQTAQLMEDAYEYVRSSTINGKKFLFVGTKRQAAGIISQ 82  Synechocystis s...
P56009         1 MVTMKDLLECGVHFGHQTRRWNPKTKKFIFGVRKNIHIIDLQKTLRYFRYTYNIVRDASAQGKSIMFVGTKKQANETLKE 80  Helicobacter py...
Q9ZE61         6 PINIKELLDAGVHFGHKTSRWNPKMASYIYGERDDVHIIDLRQSAALMSVALNAIYETVKKDGKILFVSTKIQASDIIAE 85  Rickettsia prow...
Q9Z7K9         7 KLTIKDLMSAGAHFGHQTRRWNPKMKLYIFEEKNGLYIINLAKTLQQLRNALPHIRKVIQDNKTVLFVGTKKQAKCVIRE 86  Chlamydia pneum...
O84687         6 TLTLKELLESGAHFGHQTSRWNPRMKPFIFEEKNGLYIIDLAKTLAQLKKAVACIQTTIGQEKSILFVGTKKQAKQIIRE 85  Chlamydia trach...
WP_001310531  68 TVSMRDMLKAGVHFGHQTRYWNPKMKPFIFGARNKVHIINLEKTVPMFNEALAELNKIASRKGKILFVGTKRAASEAVKD 147 Escherichia coli
WP_005645552   3 QVSMRDMINAGVHFGHQTRYWNPQMKPFIFGARNGVHIINLEKTLPLFNEALAELTRIASNNGKVLFVGTKRAASEAVQA 82  Haemophilus
1P87_B        82 AALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQd-GTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDAL 160 Escherichia coli
O83615        83 EAQRCGMFYVTNRWLGGMLTNFSTIRKSLSRLKKIERMEId-GTFEHLSKKEVASLRKEHAKLEKNLGGIKEMKELPGVV 161 Treponema palli...
Q10796        83 EATRVGMPYVNQRWLGGMLTNFSTVHKRLQRLKELEAMEQt-GGFEGRTKKEILGLTREKNKLERSLGGIRDMAKVPSAI 161 Mycobacterium t...
P74071        83 EAQRCGAHYVNQRWLGGMLTNWETIRKRVDRLKELEALEAs-GGIDRRGKKEGSMLRRELGKLQKYLGGIKNMRKLPDVV 161 Synechocystis s...
P56009        81 FAESIQVPYVNYRWLGGMLTNFSTIRKSVRKLEIIEEMENs-GQIDLLTKKEKLMILRKKEKLDKYLGGVRHMKKIPDMI 159 Helicobacter py...
Q9ZE61        86 YAEKCGQYYVNNRWLGGMLTNWKTIACSIEKLEKLEKTLEseEARICYTKKEILDMSRKKDKLLLSLAGIRNLNSKPDLL 165 Rickettsia prow...
Q9Z7K9        87 AAIEAGEFFIAERWLGGMLTNMTTIRNSIKTLDKIEKDLS--RNQAYLTKKEAALLAKRHQKLLRNLEGIRYMKKAPGLL 164 Chlamydia pneum...
O84687        86 AAIECGEFFASERWLGGMLTNMATIRNSVKTLNRIELDLE--ASNSGLTKKELALLAKRHRKLLNNLEGVRHMNSLPGLL 163 Chlamydia trach...
WP_001310531 148 AALSCDQFFVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQd-GTFDKLTKKEALMRTRELEKLENSLGGIKDMGGLPDAL 226 Escherichia coli
WP_005645552  83 AALDCQQYYVNHRWLGGMLTNWKTVRQSIKRLKDLETQSQd-GTFDKLTKKEALMRSREMEKLELSLGGIKDMGGLPDAL 161 Haemophilus
1P87_B       161 FVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQ 226 Escherichia coli
O83615       162 FIIDTRKETIAIREARRVGIPIVAVVDTNCNPEGIDYPIPGNDDAIRAISLFTQLIANAVMEAGNE 227 Treponema pallidum subsp. pal...
Q10796       162 WVVDTNKEHIAVGEARKLGIPVIAILDTNCDPDEVDYPIPGNDDAIRSAALLTRVIASAVAEGLQA 227 Mycobacterium tuberculosis
P74071       162 VIVDQRREHNAIHECQKLGIPIIAMLDTNCDPDVVDVPIPANDDAIRSIKLIVGKLADAIYEGRHG 227 Synechocystis sp. PCC 6803 su...
P56009       160 FVIDVAKEKIAVAEARKLHIPIVAPLDTNCDPDLVDYPIPGNDDAIRSIRLFCKEMSEAILEGREL 225 Helicobacter pylori 26695
Q9ZE61       166 VVIDTNKEHIAINEAVKLNIPVVAVVDTNSNPDNVDYPIPGNDDSIRSIRLYCSLFADAALQGLEE 231 Rickettsia prowazekii str. Ma...
Q9Z7K9       165 VVVDPSYEKIAVAEAKKLGIPVLALVDTNCDPTPIDHVIPCNDDSLKSIRLIINVIKENIIEAKHK 230 Chlamydia pneumoniae
O84687       164 IVIDPGYERIAVAEAGKLGIPVMALVDTNCDPTPINHVIPCNDDSMKSIRLIVNVLKDAVIDAKKR 229 Chlamydia trachomatis D/UW-3/CX
WP_001310531 227 FVIDADHEHIAIKEANNLGIPVFAIVDTNSDPDGVDFVIPGNDDAIRAVTLYLGAVAATVREGRSQ 292 Escherichia coli
WP_005645552 162 FVIGADHEHIAVKEANNLGIPVFAIVDTNSTPAGVDFVIPGNDDATRAIQLYVSAAAAAVKEGRGN 227 Haemophilus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap