1E2A


Conserved Protein Domain Family
EIIA-LAC

?
TIGR00823: EIIA-LAC 
Click on image for an interactive view with Cn3D
phosphotransferase system enzyme II, lactose-specific, factor III
The PTS Lactose-N,N?-Diacetylchitobiose-b-glucoside (Lac) Family (TC 4.A.3)Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains.The Lac family includes several sequenced lactose (b-galactoside) permeases of Gram-positive bacteria as well as the E. coli N,N?-diacetylchitobiose (Chb)permease which can transport aromatic b-glucosides and cellobiose as well as the chitin disaccharide, Chb, but only Chb induces expression of the chboperon. While the Lac permeases consist of two polypeptide chains (IIA and IICB), the Chb permease of E. coli consists of three (IIA, IIB and IIC). In B. subtilis, a PTS permease similar to the Chb permease of E. coli is believed to transport lichenan (a b-1,3;1,4 glucan) degradation products, oligosaccharides of 2-4 glucose units. This model is specific for the IIA subunit of the Lac PTS family. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129903
View PSSM: TIGR00823
Aligned: 7 rows
Threshold Bit Score: 131.79
Threshold Setting Gi: 2507270
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E2A_A   4 EEMTLLGFEIVAYAGDARSKLLEALKAAENGDFAKADSLVVEAGSCIAEAHSSQTGMLAREASGEELPYSVTMMHGQDHL 83  Lactococcus lactis
P26426   4 EEATLLGFEIVAYAGDARSKLLEALNAAQAGEYDRAEELVAAADDCIVDAHKAQTSLLAKEAQGDDIELSVTLMHGQDHL 83  Streptococcus mutans ...
P11502   6 EEISMVGFALVAYAGDARTAAVHALDAAEAGDFDKANELVEKAQQDINEAHNQQTQLLSQEAGGAEMDVTFIMVHGQDTL 85  Lactobacillus casei
P46319   3 EEMEQIIFQIILHGGNGRSSAMEAIAAAKSGDAEEARKKLQDAAEELSKAHHYQTELIQNEAGGEKTEMTLLMVHAQDHL 82  Bacillus subtilis sub...
Q45402   2 QTYEQTVFQLILHGGNGRSYAMEAITAAKKGEFAEARRLLEQAGAELQAAHGLQTALLQQEASGGQPVVTLLMVHAQDHL 81  Geobacillus stearothe...
P17335  15 EELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHL 94  Escherichia coli
P02909   4 EEVQLLGFEIVAFAGDARSKFLEALTAAQAGDFAKADALIEEGNNCIAEAHRAQTSLLAKEAQGDDIAYSVTMMHGQDHL 83  Staphylococcus aureus...
1E2A_A  84 MTTILLKDVIHHLIELYKR 102 Lactococcus lactis
P26426  84 MTTILLKDLMKHLIELYKR 102 Streptococcus mutans UA159
P11502  86 MTTMLLIDETRYMIRMFKR 104 Lactobacillus casei
P46319  83 MNAMTVKDMAAEIIELYEK 101 Bacillus subtilis subsp. subtilis str. 168
Q45402  82 MTAITVKDLAAEFVELYEA 100 Geobacillus stearothermophilus
P17335  95 MTSMLARELITELIELHEK 113 Escherichia coli
P02909  84 MTTILLKDLMKHLLEFYKR 102 Staphylococcus aureus subsp. aureus Mu50
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap