Conserved Protein Domain Family
dctM

?
TIGR00786: dctM 
TRAP transporter, DctM subunit
The Tripartite ATP-independent Periplasmic Transporter (TRAP-T) Family (TC 2.A.56)- DctM subunit TRAP-T family permeases generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. Only one member of the family has been both sequenced and functionally characterized. This system is the DctPQM system of Rhodobacter capsulatus (Forward et al., 1997). DctP is a periplasmic dicarboxylate (malate, fumarate, succinate) binding receptor that is biochemically well-characterized. DctQ is an integral cytoplasmic membrane protein with 4 putative transmembrane a-helical spanners (TMSs). DctM is a second integral cytoplasmic membrane protein with 12 putative TMSs. These proteins have been shown to be both necessary and sufficient for the proton motive force-dependent uptake of dicarboxylates into R. capsulatus. [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]
Statistics
?
PSSM-Id: 129868
View PSSM: TIGR00786
Aligned: 11 rows
Threshold Bit Score: 354.665
Threshold Setting Gi: 313843
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
BAA18318  22 GYPVAFSLGGVAILfAIIGAALGSFDPIFlsampQRIFGIMANGTLLAIPFFIFLGSMLERSGIAEQLLETMGIILGHLR 101 Synechocystis sp. P...
CAA45387  17 GMPISISLGLTVLT-FLFTMTQVPIDTVA-----LKLFTGIEKFEIMAIPFFILAGNFLTHGGVAKRMINFATAMVGHWH 90  Rhodobacter capsulatus
CAA10758   4 GVPVAVALGTSTVL-SMLLFTELDPMSIP-----QLVFDGINKFSLMAIPMFILAGNLLSKGSSARRIIDFAKSMVGHLP 77  Wolinella succinogenes
AAA56680  23 GVPITFAIGLSSLFsILIALPPDAAISVIs----QKMTVGLDGFTLLAIPFFVLAGNIMNTGGIARRLVNLAQALVGRLP 98  Salmonella enterica...
AAC34291  17 GVPIAYSLLVSGIS-LMWHLDMFDSQILA-----QNVIHGADSFPLLAVPFFMLAGEIMNTGGLSRRIVKFALTLVGHRR 90  Ralstonia sp. TFD41
P44543   207 GVPVGWSLFIATL--LYFSMTRWNVVNAAt----EKLVYSLDSFPLLAVPFYILTGILMNTGGITERIFNFAKALLGHYT 280 Haemophilus influen...
AAD35411  15 GMPVAFAIGISGF--LWFLQHPELPITIPi----QRLLSQTVNFTLLAIPMFIVAGNVMNSAGVTRRLLDFASTLVGHMR 88  Thermotoga maritima...
P55571    16 AVPVGYALIIAAG--VAVLFNGYLPLSIVa----QQIYDQTQSFPMLALPFFMLAGTLMLGGELGRQLLELASHAMQRWR 89  Sinorhizobium fredi...
AAC65914 229 GLPLFITLLAIAY--LALSVDGGYVDTLPl----EGYKILTDTGGIVAVPLFATASLLLARGSTGTRLLRLVKEAVGWLR 302 Treponema pallidum ...
CAA46095  39 GVWVGLTLAGTAWIgMEVLSSRPAGDAMA-----VTIWGASSSWTLTALPLFLWMGEILFRTRLSEDLFKGLAPWLNRLP 113 Bordetella pertussis
AAB18555  17 GLPIAWALLLCGAA-LMFWLDMFDVQIMA-----QTLVNGADSFSLLAIPFFVLAGEIMNAGGLSKRIVDLPMKLVGHKP 90  Escherichia coli st...
BAA18318 102 GGLALAVILVGTMLAATTGVVAATVVAMGLISLPIMLRYGYSKELASGVIVASGTLGQIIPPSVVLIVLADQ-------- 173 Synechocystis sp. P...
CAA45387  91 GGLGLAGVIACALFAAVSGSSPATVVAIGSVILPAMVNQGFPKQFGAGVITTSGALGILIPPSIVMVMYAVAtsgmvvtg 170 Rhodobacter capsulatus
CAA10758  78 GGLPMSAIFACIIFAAVSGSSPATVVAIGSIMFAAIKDAGYPASYAVGGITTAGSLGILIPPSIVMIVYGVT-------- 149 Wolinella succinogenes
AAA56680  99 GSLAHCNILANTLFGAISGSRVASAPAVGGIMSPLQEKEGYSPAFSTAINVASAPIGLMIPPSNVLIVYSLAs------- 171 Salmonella enterica...
AAC34291  91 GGLGFVAIVAACILAALSGSAVADTAALAALLLPMMVAAGHDKAKAGGLIASAGIIAPVVPPSVSFVIFGVA-------- 162 Ralstonia sp. TFD41
P44543   281 GGMGHVNIGASLLFSGMSGSALADAGGLGQLEIKAMRDAGYDDDICGGITAASCIIGPLVPPSIAMIIYGVI-------- 352 Haemophilus influen...
AAD35411  89 GGLGQVSAVLSTLMGGVSGSSIADAAMETRMLGPEMLKRGYPRGFAVAVNVWTSLITPIIPPGIAFIIYGTI-------- 160 Thermotoga maritima...
P55571    90 GGPLSTTVVSSVVFGGVSGSAVANASALGSVLIPWQKKHGFPPALCAANNATSAVIDVLIPPSIPMILFSLV-------- 161 Sinorhizobium fredi...
AAC65914 303 GGAAVACVAVAALFTSLTGVSGVTILALGSLFKLILTGNKYPEHDAEALITSSGAIGLLFPPSAAIIIFGATn------- 375 Treponema pallidum ...
CAA46095 114 GRLLHTNVIGCAIFAAVSGSSAATCATVGKMTIPELTRRGYPEDKILGTLSGAGTLGLLIPPSIIMIVYGVA-------- 185 Bordetella pertussis
AAB18555  91 GGLGYVGVLAAMIMASLSGSAVADTAAVAALLVPMMRSANYPVNRAAGLIASGGIIAPIIPPSIPFIIFGVS-------- 162 Escherichia coli st...
BAA18318 174 ------LGVSVGDLFIGSLLPGLMMAGSFALYVLIIAWLKPDLAPAlpaevrnIGGQELRRRIVQVMLPPLVLILLVLGS 247 Synechocystis sp. P...
CAA45387 171 pdgqpvSSASVGELFMAGVVPGLMLAGFLAFTTWNRARKFGYPRLE-------KASLRQRWTAFREAAWGLMLIVVVIGG 243 Rhodobacter capsulatus
CAA10758 150 ------AEESIGKLFMAGVIPGLMIGAMMMLQTYWGAKRLGFKATE-------PAPFRERLQKLGKAFWALMVIFVVIGG 216 Wolinella succinogenes
AAA56680 172 ------GGTSVAALFLAGYLPGILTALALMTVAALYAHRHHYPVAE-------RINLRQFLSVFRDSLPSLLLIFIIIGG 238 Salmonella enterica...
AAC34291 163 ------ANVSVSKLFLAGIVPGALMGLAIAATWWFVARAENVEPAP-------KAHTSEKLAAFKEAIWALFLPVIVIVG 229 Ralstonia sp. TFD41
P44543   353 ------ANESIAKLFIAGFIPGVLITLALMAMNYRIAKKRGYPRTP-------KATREQLCSSFKQSFWAILTPLLIIGG 419 Haemophilus influen...
AAD35411 161 ------GQVSIGRLFAAGIGPGLLLMIVYMITIWFVAKRLNLAPERe-----rRAPVNEVFRSLGKSIWALMFPVLLIVG 229 Thermotoga maritima...
P55571   162 ------SGVSVANLFVAGILPGILMAASFVFVCWFVSVRRGYASQPs------QTSRRQLATLALKSLPAVLLPVLIILF 229 Sinorhizobium fredi...
AAC65914 376 -----iLTVHIVDLFKGALLPGTLLVLSAMCLGVAKDRTQVRPSFS-------WQLL--V-HAVRGSVFDLALPVCISLG 440 Treponema pallidum ...
CAA46095 186 ------ADVSIAKLFIAGIFPGLLLALLFMGYIAWWAIRHPGAVPAad----pGISFMQKLKQSRHLIPVLLLIGAVLGS 255 Bordetella pertussis
AAB18555 163 ------SGLSISKLFMAGIAPGMMMGATLMLTWWWQASRLNLPRQQ-------KATMQEIWHSFVSGIWALFLPVIIIGG 229 Escherichia coli st...
BAA18318 248 IFFGIASPTEAGAVGSIGAIALA-HFNQRLNWKALWEVCDA-TLRITSMVMLILLGSTAFSLVFRGLEGDRFMFDLLANL 325 Synechocystis sp. P...
CAA45387 244 IYAGIFTPTEAAAMSAVYAFFISvFVYKDLTLRDVPRVLLS-SANMSAMLLYIITNAVLFSFLMAHEGIPQALGEWMVNA 322 Rhodobacter capsulatus
CAA10758 217 IYGGIFTPTEAAAVSAVYAFVISyFVYKDIQLKDLYKVFLE-SAMTTSMIFFIIANAVVFAHFLTSEQIPQTIAQTILDH 295 Wolinella succinogenes
AAA56680 239 IIGGVFTPTEASAIAVIYSLALA-AIYREINVSKLRDILLD-SVVTSSIVLLLVGCSMGMSWAMTNADVPELINEMITSV 316 Salmonella enterica...
AAC34291 230 LKMGVFTPTEAGVIAAVYSLIIStLEYKELRLAQLFDVFVN-AAKTTSIILFLAAAAMVSAWLINVADIPSQAIDLLGPL 308 Ralstonia sp. TFD41
P44543   420 IFSGLFSPTESAIVAAAYSVIIGkFVYKELTLKSLFNSCIE-AMAITGVVALMIMTVTFFGDMIAREQVAMRVADVFVAV 498 Haemophilus influen...
AAD35411 230 LRGGIFTPSEVGSFAVLYGMLVGfIIHREMSLKTFYWETLEnSLGDIGSVMFILSMSTIFGYGMIWERIPEKLAEFLLGI 309 Thermotoga maritima...
P55571   230 LRFGLATPTEVAVLSVVYSLALSlLYYRDLTWKRFCDNVVE-AGMATGVVMLVIMGSAAVGWVLTFDQAPQQMADWVAAN 308 Sinorhizobium fredi...
AAC65914 441 YFSGTLNLLQCASLTTLLAFVLGtWVRRDFTVKEACATALE-SLPIVGGILIIVAAAKGLSFYLVDANVPDTLIAFLQHA 519 Treponema pallidum ...
CAA46095 256 IYTGIATATEAAAVGVVGALILS-ALQGSLTRTSFMTSLLG-ATRLYCMIALILAGAQFLPGHGLHRPAP-RAGRVDRRA 332 Bordetella pertussis
AAB18555 230 FRSGLFTPTEAGAVAAFYALFVAtVIYREMTFATLWHVLIG-AAKTTSVVMFLVASAQVSAWLITIAELPMMVSDLLQPL 308 Escherichia coli st...
BAA18318 326 PGGQIGFLAISMITIFILGFFIDFFEIAFIVLPLFKPVAEALNLDLIWYGVIVGANLQTSFLTPPFGFALFYLRGVAPAS 405 Synechocystis sp. P...
CAA45387 323 GLSWWMFLIIVNILLLAAGNFMEPSSIVLIMAPILFPVAVRLGIDPVHFGIMIVVNMEVGMCHPPVGLNLYVASGITKMG 402 Rhodobacter capsulatus
CAA10758 296 NVGKIGFLILVNIILFIMGQFMEPSSVVMIMVPLLLPIATELGIDPIHFGIIMVVNMELGMITPPVGLNLFVASGLTGMS 375 Wolinella succinogenes
AAA56680 317 SENKWVILLIINLILLFVGTFMDITPAILIFTPIFLPIAQHLGIDPVHFGIIMVFNLTIGLCTPPVGTILFVGCSIGKIS 396 Salmonella enterica...
AAC34291 309 MDSPILLMFAIMVLVMLVGTAMDMMPTILVMTPVLVPVVKAAGIDPVYFGVLFIMNNAIGLVTPPVGTVLNVVAGVGPIS 388 Ralstonia sp. TFD41
P44543   499 ADSPLTVLIMINALLLFLGMFIDALALQFLVLPMLIPIAMQFNIDLIFFGVMTTLNMMVGILTPPMGMALFVVARVGNMS 578 Haemophilus influen...
AAD35411 310 SSNPNVLMIMISLFLVFAGLFVDATALILMLTAILLPVAEQVGIDPVHFGLVFILSAAMGNQTPPVGASMYAGCSVLDAT 389 Thermotoga maritima...
P55571   309 ISSPIVIILMMNILMLIVGMPLDMPPAILLLGPIFVPLADTIGLDRVQLGLMMVINLGIGLYTPPIGTTLFISSSIAKSP 388 Sinorhizobium fredi...
AAC65914 520 ISSKYAFLLLLNVLLLGVGCIMDLYSAILVISPLVLPLAVHFGVHPVHASVVFLMNLELGALTPPIGMNLFIASFAFEKP 599 Treponema pallidum ...
CAA46095 333 GPVPVRPDHGLDGVLRRAGLLPG---RHFHRRPDHGRAAAHRAGRRHRPDLVRHLHRVRG-------------------- 389 Bordetella pertussis
AAB18555 309 VDSPRLLFIVIMVAILIVGMVMDLTPTVLILTPVLMPLVKEAGIDPIYFGVMFIINCSIGLITPPIGNVLNVISGVAKLK 388 Escherichia coli st...
BAA18318 406 LTtgQIYRGAVPFIGLQVLVLLLIIIFPALINWLP 440 Synechocystis sp. PCC 6803
CAA45387 403 IT--ELTVAVWPWLLTMLAFLVLVTYVPAISLALP 435 Rhodobacter capsulatus
CAA10758 376 LK--DVVIASLPWTITIFIGLILVTYVPAISLWLP 408 Wolinella succinogenes
AAA56680 397 ID--KVVKPLLPMFLALFVVMAMICYFPQLSLLLP 429 Salmonella enterica subsp. enterica serovar Typhimurium
AAC34291 389 R---------------------------------- 389 Ralstonia sp. TFD41
P44543   579 VS--TVTKGVLPFLIPVFVTLVLITIFPQIITFVP 611 Haemophilus influenzae Rd KW20
AAD35411 390 ME--EYIQASWPFLFVTILAILIVIFFPQIVLFIP 422 Thermotoga maritima MSB8
P55571   389 LG--ETTRELWPFFAMAMTLLLAVSFIPALTLY-- 419 Sinorhizobium fredii NGR234
AAC65914 600 IV--YLTRAIAPFLLAQLGVLLLTTYIPWLSTAFL 632 Treponema pallidum subsp. pallidum str. Nichols
CAA46095     -----------------------------------     Bordetella pertussis
AAB18555 389 FD--RCSQRRFP-LRPGFIFIISRICFYSRSHHPP 420 Escherichia coli str. K-12 substr. MG1655
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap