Conserved Protein Domain Family
sbcc

?
TIGR00618: sbcc 
exonuclease SbcC
All proteins in this family for which functions are known are part of an exonuclease complex with sbcD homologs. This complex is involved in the initiation of recombination to regulate the levels of palindromic sequences in DNA. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129705
View PSSM: TIGR00618
Aligned: 5 rows
Threshold Bit Score: 817.285
Threshold Setting Gi: 18202107
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O83635          1 MKPMRLTLHNIGPFVGTHTVDFTALG----PIFLVCGKTGSGKTTLFDAIAYALYGKpLGTRAEVIRSLRSHYAAPSEAA 76   Treponema pal...
AAC65599        1 MKPMRLTLHNIGPFVGTHTVDFTALG----PIFLVCGKTGSGKTTLFDAIAYALYGKpLGTRAEVIRSLRSHYAAPSEAA 76   Treponema pal...
P13458          1 MKILSLRLKNLNSLKGEWKIDFTREPfasnGLFAITGPTGAGKTTLLDAICLALYHE-TPRLSNVSQSQNDLMTRDTAEC 79   Escherichia c...
O67124          1 MRPLKLEVKGFTVYKKPQVIDFTPl-----KFFVIQGKTGAGKTSIIDAITYALYGK-VPRYGASVATKYVLSRG----- 69   Aquifex aeoli...
WP_010871660    1 MVPQQLILKNFLSYQDVSLNFRGl------HTACICGSNGAGKSSLLEAITWAIWGK-CRAESEDDVLHNGTDQVR---- 69   Synechocystis...
O83635         77 FATLEFSLGTKIYRVHRTLTCTLSHRKTEQPEQLYLEQKKGHGweRIACAHKSETECVIHDLLKLNSKEFERVVMLPQGE 156  Treponema pal...
AAC65599       77 FATLEFSLGTKIYRVHRTLTCTLSHRKTEQPEQLYLEQKKGHGweRIACAHKSETECVIHDLLKLNSKEFERVVMLPQGE 156  Treponema pal...
P13458         80 LAEVEFEVKGEAYRAFWSQNRARNQPDGNLQVPRVELARCADG--KILADKVKDKLELTATLTGLDYGRFTRSMLLSQGQ 157  Escherichia c...
O67124         70 EKELKVALDFSLRG--RNYRVERYYREFPEDSQVRVYEEGRR-----LNIKANEVEKWLFKISGLDYKTFTKVILLPQGE 142  Aquifex aeoli...
WP_010871660   70 -VDFEFISNNQTYR---IIRSRQRGRSSVTEFQIKSG-DHFR---TLSAKGLRATQEKITNTLKLDYETFVNSAYLRQGR 141  Synechocystis...
O83635        157 CAQFLKANSKEKKETL--MNLFPVDQYT--ALMERAKKKSLHAKAVLETLRSQLETLCAECMPDTYHERKQTLEAELQHA 232  Treponema pal...
AAC65599      157 CAQFLKANSKEKKETL--MNLFPVDQYT--ALMERAKKKSLHAKAVLETLRSQLETLCAECMPDTYHERKQTLEAELQHA 232  Treponema pal...
P13458        158 FAAFLNAKPKERAELL--EELTGTEIYGqiSAMVFEQHKSARTELEKLQAQASGVTLLTPEQVQSLTASLQVLTDEEKQL 235  Escherichia c...
O67124        143 FDRFLKESSERKKILInlLGLEELEKVRqlASETFKN---LEGKREALKKEYELLKDYTP-------TKKEVLEKTLKNL 212  Aquifex aeoli...
WP_010871660  142 ADEFMLRKPSERKQIL--ADLLKLDQYEmlATRAKDISkEAKGKINILDERLQILEQDLNQR----PDVVANQAKLVAEI 215  Synechocystis...
O83635        233 RDALQQTRISHAYYTQKREALEAQLKKQQLCKELRARIETYRAQEPVHAETQKRIDRARKAAPLAAHIKHVTQCEQDAQR 312  Treponema pal...
AAC65599      233 RDALQQTRISHAYYTQKREALEAQLKKQQLCKELRARIETYRAQEPVHAETQKRIDRARKAAPLAAHIKHVTQCEQDAQR 312  Treponema pal...
P13458        236 ITAQQQEQQSLNWLTRQDELQQEASRRQQALQQALAEEEKAQPQLAALSLAQPARNLRPHWERIAEHSAALAHIRQQIEE 315  Escherichia c...
O67124        213 EEELKELKETEEKLRQELKKAEEKDSLERELSQVVTKLKELENLEKEVEKLREKLEFSRKVAPYVPIAKRIEEIDKK--- 289  Aquifex aeoli...
WP_010871660  216 TEVQAQQQQTQWQLQQLQTSQNQRQQWQKQAGWQQRQCQELTTEIARLENQNEEINQQCQKLKLLLEQEAVIQVNFQr-- 293  Synechocystis...
O83635        313 IHAEIQEKMRSREQLLMKRAAHVAQQSSIEEQRRLLQTLHSACIHIEDAHDVATSIRDISCQAHTLTQHIHTLAQQKTTL 392  Treponema pal...
AAC65599      313 IHAEIQEKMRSREQLLMKRAAHVAQQSSIEEQRRLLQTLHSACIHIEDAHDVATSIRDISCQAHTLTQHIHTLAQQKTTL 392  Treponema pal...
P13458        316 VNTRLQSTMALRASIRHH---AAKQSAELQQQQQSLNTWLQEHDRFRQWNNEPAGWRAQFSQQTSDREHLRQWQQQLTHA 392  Escherichia c...
O67124        290 -LTELKVRKNKLTKELA----VLKDELS-----------FAQEELNRIEAEKEK-FKEEKEREKELEHRLKKLQEIKEIL 352  Aquifex aeoli...
WP_010871660  294 -YQTLQSQETELAKAFQQYQNLQQQRQD------LEQQLQRQENELARQTEQQLLRLEHLDKQLAELQPILAQQQDIEAD 366  Synechocystis...
O83635        393 TQQEQSLCKELDILQR-EAGTIDTRTSAFNDLQIQLAHAKKTQELSQRYAELCAAHATCTAQCEKLEKIHAQKSAYSTRA 471  Treponema pal...
AAC65599      393 TQQEQSLCKELDILQR-EAGTIDTRTSAFNDLQIQLAHAKKTQELSQRYAELCAAHATCTAQCEKLEKIHAQKSAYSTRA 471  Treponema pal...
P13458        393 EQKLNALAAITLTLTAdEVATALAQHAEQRPLRQHLVALHGQIVPQQKRLAQLQVAIQNVTQEQTQRNAALNEMRQRYKE 472  Escherichia c...
O67124        353 KELSQLSSSLKEKEREyEQAKQEFEDLSERVEKGKKLVAETEEKLEK----IKELFSEEEYTSLKMKERLLVELQRKLKE 428  Aquifex aeoli...
WP_010871660  367 LDKLKIAKQKLSQLDN-LQHQVAPLLQRRSALQGDLARARAQCQAQLe----QRQAIAKQLQIAIAAIPEQRRAFQALDE 441  Synechocystis...
O83635        472 REQLLQTKEQIHLQETRTHAVVLARLLEHQ-EPCPVCGSCIHPNPARQDIDNLEPLTRRMQRIEQTYAQLETSEKDVYHI 550  Treponema pal...
AAC65599      472 REQLLQTKEQIHLQETRTHAVVLARLLEHQ-EPCPVCGSCIHPNPARQDIDNLEPLTRRMQRIEQTYAQLETSEKDVYHI 550  Treponema pal...
P13458        473 KTQQLADVKTICEQEARIKTLEAQRAQLQAgQPCPLCGSTSHPAVEAYQALEPGVNQSRLLALENEVKKLGEEGATLRGQ 552  Escherichia c...
O67124        429 LKEKEGQLENLTQKYKEKKKVHEKVLNELKeLERELKERELHYHAHMVASYLSPGDTCPVCGGIYR---G-KALENVDAE 504  Aquifex aeoli...
WP_010871660  442 EIFQLKNKQVYLKRVEEKGQERGHFKERLQeNQRLFEKQLRELEQKLTLLGIPGATCPLCEQGLDGh-YHQQVIEKTEHQ 520  Synechocystis...
O83635        551 LTSERERRASYSAQMQEIQHSFSIL-TSCDTRSSCDIPNVQKITVRVLDLTEKLSRAKDMLACAQHALLRKKQPEQDLQD 629  Treponema pal...
AAC65599      551 LTSERERRASYSAQMQEIQHSFSIL-TSCDTRSSCDIPNVQKITVRVLDLTEKLSRAKDMLACAQHALLRKKQPEQDLQD 629  Treponema pal...
P13458        553 LDAITKQLQRDENEAQSLRQDEQAL-TQQWQAVTASLNITLQPLDDIQPWLDAQDEHERQLRLLSQRHELQGQIAAHNQQ 631  Escherichia c...
O67124        505 GISELKHAKELKEKEEREIDTTLKLyAQKINSLKEEMEKLRNEVEELRKEIPENLKERIKKLEELRIEKEKLEHKLNKYR 584  Aquifex aeoli...
WP_010871660  521 CQELRNQIWILKEQITLADQEL----AILRNEYKEIADGLTNLEQLLQHYGQMEAELEKS--GENHEQLVELNEQIADLE 594  Synechocystis...
O83635        630 VRAHLQQCSQELAKKETALHALQETLTQQRVRIHALSIR-LPKELLASNLLAPQKMQHEKESVAYWKEMLAHCQTLMREL 708  Treponema pal...
AAC65599      630 VRAHLQQCSQELAKKETALHALQETLTQQRVRIHALSIR-LPKELLASNLLAPQKMQHEKESVAYWKEMLAHCQTLMREL 708  Treponema pal...
P13458        632 IIQYQQQIEQRQQLLLTTLTGYALTLPQEDEEESWLATRqQEAQSWQQRQNELTALQNRIQQLTPILETLPQSDELPHCE 711  Escherichia c...
O67124        585 KALEDRQKQKEEAQAKLHKAQTELELLKEKIREKSRLVKeFKELY--RVERLEDYEESL-------KEEINYINSKLQEI 655  Aquifex aeoli...
WP_010871660  595 LSLTEGNFAESLQLELAALERELTNLAYDEQTHALARSTvDQLRKGEIRQAKLKEAQSKYRQLTGDRPGLEQKLLALRSQ 674  Synechocystis...
O83635        709 HTHIEEYDREFNEIENASSALGADIAAREDALNHVQKEYMHLARTVCCARTEAHFN-NNEEVTAALMTDAELSHAAAEIQ 787  Treponema pal...
AAC65599      709 HTHIEEYDREFNEIENASSALGADIAAREDALNHVQKEYMHLARTVCCARTEAHFN-NNEEVTAALMTDAELSHAAAEIQ 787  Treponema pal...
P13458        712 ETVVLENWRQVHEQCLALHSQQQTLQQQDVLAAQSLQKAQAQFDTALQASVFDDQQ-AFLAALMDEQTLTQLEQLKQNLE 790  Escherichia c...
O67124        656 EEKEKKLRKHFEELS----SRKSKLEGELSALNESINSLEEERKEKLKELANIYEVaKSPREVVELYLGDKEAELER--- 728  Aquifex aeoli...
WP_010871660  675 LQSLGTSSPLRQQWQQVS-TAISELNYNNETHQQLLGELRRQQPWQLKHQELEQAR---QQLPILIQRGQEYQDLIGD-- 748  Synechocystis...
O83635        788 FFNELRAADTHLLKTLEAEIGTEIPSDLDELNAQCHTLVKDEENFLSRIEILS---ATLHTLTHQYLKYEECSKQLAQKT 864  Treponema pal...
AAC65599      788 FFNELRAADTHLLKTLEAEIGTEIPSDLDELNAQCHTLVKDEENFLSRIEILS---ATLHTLTHQYLKYEECSKQLAQKT 864  Treponema pal...
P13458        791 NQRRQAQTLVTQTAETLAQHQQHRPDDGLALTVTVEQIQQELAQTHQKLRENT---TSQGEIRQQLKQDADNRQQQQTLM 867  Escherichia c...
O67124        729 -KIKEFEESFQSLKLKKSEIEEKLKEYEGIRELSDIK--GEYESVKTQLEEKH---KKLGEVKRELEHLGERLKRKEEL- 801  Aquifex aeoli...
WP_010871660  749 -RQRALEERQGELAQLEEQIRQYADHGEQIKLLEQEL-AQRRQQLDNLLAKKGgleQLLIQIDTLQGEYEETKQQFDQA- 825  Synechocystis...
O83635        865 QESAKLITLSDELNGINQKKIQFDAWALISFLHEITAYANIRLQKMSEGRYHLRVADSHVNARGYQGLALLVADAYT-GS 943  Treponema pal...
AAC65599      865 QESAKLITLSDELNGINQKKIQFDAWALISFLHEITAYANIRLQKMSEGRYHLRVADSHVNARGYQGLALLVADAYT-GS 943  Treponema pal...
P13458        868 QQIAQMTQQVEDWGYLNSLIGSKEGDKFRKFAQGLTLDNLVHLANQQLTRLHGRYLLQRKAS--EALEVEVVDTWQA-DA 944  Escherichia c...
O67124        802 --QKEISELEKKLEVYRVISNDFRGDRFQKYVSEIMLQKVVDRASEYFYKFTGNYFFELERATKGRDKDIVVVESST-SQ 878  Aquifex aeoli...
WP_010871660  826 KKQFRIHQELGKAFGKDGIQVMIIENILPQLEAETNYILARLTGNQHHIQFVTQKEGKSSTKNKPKMINTLDILIADaQG 905  Synechocystis...
O83635        944 VRPSATLSGGETFMASISLALGLADSIQTrSGGIVLDSLFIDEGFGSLDEASLDKAIGILDEIRE-GSRMIGIISHVHEL 1022 Treponema pal...
AAC65599      944 VRPSATLSGGETFMASISLALGLADSIQTrSGGIVLDSLFIDEGFGSLDEASLDKAIGILDEIRE-GSRMIGIISHVHEL 1022 Treponema pal...
P13458        945 VRDTRTLSGGESFLVSLALALALSDLVS---HKTRIDSLFLDEGFGTLDSETLDTALDALDALNA-SGKTIGVISHVEAM 1020 Escherichia c...
O67124        879 RRPVSSLSGGETFLASLSFAFAVSDLLS---GSANLESLFIDEGFGSLDQDMRERVSEILEAIKTnVNKMIGIVSHIPDF 955  Aquifex aeoli...
WP_010871660  906 TRPYETYSGGEAFRINFSIRLALAKLLAQ-RSGTALQLLIIDEGFGTQDADGCDRLVAAITAIASdFACILTVT-HMPQF 983  Synechocystis...
O83635       1023 RTRIPHKILIKKTNAGSHVM 1042 Treponema pallidum subsp. pallidum str. Nichols
AAC65599     1023 RTRIPHKILIKKTNAGSHVM 1042 Treponema pallidum subsp. pallidum str. Nichols
P13458       1021 KERIPVQIKVKKINGLGYSK 1040 Escherichia coli K-12
O67124        956 AERFTERIVVEKKGDYSEVR 975  Aquifex aeolicus VF5
WP_010871660  984 REAFQQRIEVNKTEFGSQLA 1003 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap