2H5E


Conserved Protein Domain Family
prfC

?
TIGR00503: prfC 
Click on image for an interactive view with Cn3D
peptide chain release factor 3
This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. More recently, RF-3 was shown to be active primarily at UGA stop codons in E. coli. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis PCC6803, and in Staphylococcus aureus. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129594
Aligned: 3 rows
Threshold Bit Score: 980.161
Threshold Setting Gi: 2494263
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H5E_A   3 LSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGTVKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYHDC 82  Escherichia coli
P73473  16 LDDLLKEVDRRRNFAIISHPDAGKTTLTEKLLLYGGAIQEAGAVKARRSQRSATSDWMAMEQQRGISITSTVLQFDYRGK 95  Synechocystis sp. PCC...
P43928   1 MSYPLEEVNKRRTFAIISHPDAGKTTITEKVLLYGNAIQTAGSVKGKGSAAHAKSDWMEMEKQRGISITTSVMQFPYNDC 80  Haemophilus influenza...
P73473  16 LDDLLKEVDRRRNFAIISHPDAGKTTLTEKLLLYGGAIQEAGAVKARRSQRSATSDWMAMEQQRGISITSTVLQFDYRGK 95  Synechocystis sp. PCC...
P43928   1 MSYPLEEVNKRRTFAIISHPDAGKTTITEKVLLYGNAIQTAGSVKGKGSAAHAKSDWMEMEKQRGISITTSVMQFPYNDC 80  Haemophilus influenza...
2H5E_A  83 LVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENEL 162 Escherichia coli
P73473  96 ILNLLDTPGHQDFSEDTYRTLAAADNAVMLIDAAKGLETQTRKLFEVCRLRHLPIFTFINKLDRPSLTPLELMDEIEQEL 175 Synechocystis sp. PCC...
P43928  81 LVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDSAKGVEERTIKLMEVTRLRDTPIITFMNKLDRDIRDPIELLDEVENVL 160 Haemophilus influenza...
P73473  96 ILNLLDTPGHQDFSEDTYRTLAAADNAVMLIDAAKGLETQTRKLFEVCRLRHLPIFTFINKLDRPSLTPLELMDEIEQEL 175 Synechocystis sp. PCC...
P43928  81 LVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDSAKGVEERTIKLMEVTRLRDTPIITFMNKLDRDIRDPIELLDEVENVL 160 Haemophilus influenza...
2H5E_A 163 KIGCAPITWPIGCGKLFKGVYHLYKDETYLYQ-SGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNEF 241 Escherichia coli
P73473 176 GMNTYAVNYPIGTGDRFRGVYNRLTKTIHLFErTGTHGSKKAADQTMALDDPALESLLGSDVYAEFQDELELIEEAGAEF 255 Synechocystis sp. PCC...
P43928 161 KIRCAPITWPIGCGKLFKGVYHLAKDETYLYQ-SGQGSTIQAVRVVKGLNNPELDVAVGDDLAQQLREELELVQGASNEF 239 Haemophilus influenza...
P73473 176 GMNTYAVNYPIGTGDRFRGVYNRLTKTIHLFErTGTHGSKKAADQTMALDDPALESLLGSDVYAEFQDELELIEEAGAEF 255 Synechocystis sp. PCC...
P43928 161 KIRCAPITWPIGCGKLFKGVYHLAKDETYLYQ-SGQGSTIQAVRVVKGLNNPELDVAVGDDLAQQLREELELVQGASNEF 239 Haemophilus influenza...
2H5E_A 242 DKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEASEDKFTGFVFKIQANMDPKHRDRVAFMRVV 321 Escherichia coli
P73473 256 DLAAVHGGEMTPVFFGSAMNNFGVELFLQAFLQYAAKPEAHDSNRGTIEPTYEEFSGFVFKLQANMDPKHRDRIAFLRVC 335 Synechocystis sp. PCC...
P43928 240 EQDAFIKGELTPVFFGTALGNFGVDHFLDGLTQWAPKPQSRQADTRTVESAEEKFSGFVFKIQANMDPKHRDRVAFMRVV 319 Haemophilus influenza...
P73473 256 DLAAVHGGEMTPVFFGSAMNNFGVELFLQAFLQYAAKPEAHDSNRGTIEPTYEEFSGFVFKLQANMDPKHRDRIAFLRVC 335 Synechocystis sp. PCC...
P43928 240 EQDAFIKGELTPVFFGTALGNFGVDHFLDGLTQWAPKPQSRQADTRTVESAEEKFSGFVFKIQANMDPKHRDRVAFMRVV 319 Haemophilus influenza...
2H5E_A 322 SGKYEKGMKLRQVRTAKDVVISDALTFMAGDRSHVEEAYPGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRI 401 Escherichia coli
P73473 336 SGKFEKDMVVKHPRTGKTVRLSRPQKLFAQERESVDIAYAGDVIGLNNPGAFTIGDTVHTGEKIIYPPIPSFSPELFAYL 415 Synechocystis sp. PCC...
P43928 320 SGKYEKGMKLKHVRIGKDVVISDALTFMAGDRAHAEEAYAGDIIGLHNHGTIQIGDTFTQGETLKFTGIPNFAPELFRRI 399 Haemophilus influenza...
P73473 336 SGKFEKDMVVKHPRTGKTVRLSRPQKLFAQERESVDIAYAGDVIGLNNPGAFTIGDTVHTGEKIIYPPIPSFSPELFAYL 415 Synechocystis sp. PCC...
P43928 320 SGKYEKGMKLKHVRIGKDVVISDALTFMAGDRAHAEEAYAGDIIGLHNHGTIQIGDTFTQGETLKFTGIPNFAPELFRRI 399 Haemophilus influenza...
2H5E_A 402 RLKDPLKQKQLLKGLVQLSEEGAVQVFRPISNN--DLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECAdA 479 Escherichia coli
P73473 416 RSTDPSQYKNFKKGVSELQEEGAVQILQSLDESkrDPILAAVGQLQFEVVQYRLQEEYGVETRLEPLGFSLARWVVEG-W 494 Synechocystis sp. PCC...
P43928 400 RLKDPLKQKQLLKGLVQLSEEGAVQVFRPLLNN--DLIVGAVGVLQFDVVVSRLKTEYNVEAIYENVNVATARWVECAdE 477 Haemophilus influenza...
P73473 416 RSTDPSQYKNFKKGVSELQEEGAVQILQSLDESkrDPILAAVGQLQFEVVQYRLQEEYGVETRLEPLGFSLARWVVEG-W 494 Synechocystis sp. PCC...
P43928 400 RLKDPLKQKQLLKGLVQLSEEGAVQVFRPLLNN--DLIVGAVGVLQFDVVVSRLKTEYNVEAIYENVNVATARWVECAdE 477 Haemophilus influenza...
2H5E_A 480 KKFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH 529 Escherichia coli
P73473 495 DALEKAGRLFNTVVVKDRWDAPVLLFKNQWNLEQVAGDCLDLKLSAIAIP 544 Synechocystis sp. PCC 6803 substr. Kazusa
P43928 478 KKFEEFKRKNEQNLALDGGDNLTYIAPTMVNLNLAQERYPDVVFYKTREH 527 Haemophilus influenzae Rd KW20
P73473 495 DALEKAGRLFNTVVVKDRWDAPVLLFKNQWNLEQVAGDCLDLKLSAIAIP 544 Synechocystis sp. PCC 6803 substr. Kazusa
P43928 478 KKFEEFKRKNEQNLALDGGDNLTYIAPTMVNLNLAQERYPDVVFYKTREH 527 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap