2H5E


Conserved Protein Domain Family
prfC

?
TIGR00503: prfC 
Click on image for an interactive view with Cn3D
peptide chain release factor 3
This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. More recently, RF-3 was shown to be active primarily at UGA stop codons in E. coli. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis PCC6803, and in Staphylococcus aureus. [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129594
View PSSM: TIGR00503
Aligned: 3 rows
Threshold Bit Score: 980.161
Threshold Setting Gi: 2494263
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H5E_A   3 LSPYLQEVAKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGTVKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYHDC 82  Escherichia coli
P73473  16 LDDLLKEVDRRRNFAIISHPDAGKTTLTEKLLLYGGAIQEAGAVKARRSQRSATSDWMAMEQQRGISITSTVLQFDYRGK 95  Synechocystis sp. PCC...
P43928   1 MSYPLEEVNKRRTFAIISHPDAGKTTITEKVLLYGNAIQTAGSVKGKGSAAHAKSDWMEMEKQRGISITTSVMQFPYNDC 80  Haemophilus influenza...
2H5E_A  83 LVNLLDTPGHEDFSEDTYRTLTAVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMELLDEVENEL 162 Escherichia coli
P73473  96 ILNLLDTPGHQDFSEDTYRTLAAADNAVMLIDAAKGLETQTRKLFEVCRLRHLPIFTFINKLDRPSLTPLELMDEIEQEL 175 Synechocystis sp. PCC...
P43928  81 LVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDSAKGVEERTIKLMEVTRLRDTPIITFMNKLDRDIRDPIELLDEVENVL 160 Haemophilus influenza...
2H5E_A 163 KIGCAPITWPIGCGKLFKGVYHLYKDETYLYQ-SGKGHTIQEVRIVKGLNNPDLDAAVGEDLAQQLRDELELVKGASNEF 241 Escherichia coli
P73473 176 GMNTYAVNYPIGTGDRFRGVYNRLTKTIHLFErTGTHGSKKAADQTMALDDPALESLLGSDVYAEFQDELELIEEAGAEF 255 Synechocystis sp. PCC...
P43928 161 KIRCAPITWPIGCGKLFKGVYHLAKDETYLYQ-SGQGSTIQAVRVVKGLNNPELDVAVGDDLAQQLREELELVQGASNEF 239 Haemophilus influenza...
2H5E_A 242 DKELFLAGEITPVFFGTALGNFGVDHMLDGLVEWAPAPMPRQTDTRTVEASEDKFTGFVFKIQANMDPKHRDRVAFMRVV 321 Escherichia coli
P73473 256 DLAAVHGGEMTPVFFGSAMNNFGVELFLQAFLQYAAKPEAHDSNRGTIEPTYEEFSGFVFKLQANMDPKHRDRIAFLRVC 335 Synechocystis sp. PCC...
P43928 240 EQDAFIKGELTPVFFGTALGNFGVDHFLDGLTQWAPKPQSRQADTRTVESAEEKFSGFVFKIQANMDPKHRDRVAFMRVV 319 Haemophilus influenza...
2H5E_A 322 SGKYEKGMKLRQVRTAKDVVISDALTFMAGDRSHVEEAYPGDILGLHNHGTIQIGDTFTQGEMMKFTGIPNFAPELFRRI 401 Escherichia coli
P73473 336 SGKFEKDMVVKHPRTGKTVRLSRPQKLFAQERESVDIAYAGDVIGLNNPGAFTIGDTVHTGEKIIYPPIPSFSPELFAYL 415 Synechocystis sp. PCC...
P43928 320 SGKYEKGMKLKHVRIGKDVVISDALTFMAGDRAHAEEAYAGDIIGLHNHGTIQIGDTFTQGETLKFTGIPNFAPELFRRI 399 Haemophilus influenza...
2H5E_A 402 RLKDPLKQKQLLKGLVQLSEEGAVQVFRPISNN--DLIVGAVGVLQFDVVVARLKSEYNVEAVYESVNVATARWVECAdA 479 Escherichia coli
P73473 416 RSTDPSQYKNFKKGVSELQEEGAVQILQSLDESkrDPILAAVGQLQFEVVQYRLQEEYGVETRLEPLGFSLARWVVEG-W 494 Synechocystis sp. PCC...
P43928 400 RLKDPLKQKQLLKGLVQLSEEGAVQVFRPLLNN--DLIVGAVGVLQFDVVVSRLKTEYNVEAIYENVNVATARWVECAdE 477 Haemophilus influenza...
2H5E_A 480 KKFEEFKRKNESQLALDGGDNLAYIATSMVNLRLAQERYPDVQFHQTREH 529 Escherichia coli
P73473 495 DALEKAGRLFNTVVVKDRWDAPVLLFKNQWNLEQVAGDCLDLKLSAIAIP 544 Synechocystis sp. PCC 6803 substr. Kazusa
P43928 478 KKFEEFKRKNEQNLALDGGDNLTYIAPTMVNLNLAQERYPDVVFYKTREH 527 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap