Conserved Protein Domain Family
PTZ00204

?
PTZ00204: PTZ00204 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 140231
View PSSM: PTZ00204
Aligned: 10 rows
Threshold Bit Score: 170.941
Threshold Setting Gi: 72392160
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71746148  22 GFSLTAAVCCEVVALKQRRYIVKILKKGnsgafscsciligtlrwwpmallvrgryhevtkkilkrqkgekgkiFCHCAT 101
72385471   1 MFQLVSVAEVNKAYVSYPGGVSMCLRFP----------------------------------------------FCHCVW 34 
72385459   1 MFQLVSAAEVNKAYVSYPGGVSMCLRFP----------------------------------------------FCHCVW 34 
72385481   1 MFQLVSVAEVNKAYVSYPGGVSMCLRFP----------------------------------------------FCHCVW 34 
84043370   1 MFQLVSTAELNKACVSYRGGVSMCLRFP----------------------------------------------FCHCVW 34 
84043396   1 MFQLVSVAEVNKAYVSYPGGVFMCLLFP----------------------------------------------FCHCVW 34 
84043402   1 ----------------------MCLRFP----------------------------------------------FCHCVW 12 
72392160     --------------------------------------------------------------------------------    
72387494   1 MFQLVSAAEVNKAHVSYPGGVSMCLRFP----------------------------------------------FCHCVW 34 
72389701   1 MFQLVSAAEVNKAYVSYPGGVSMCLLFP----------------------------------------------FCHCVW 34 
71746148 102 ADAMILHESPHHYCKWAARGGSEDWDYSNSFVVVCAVLLENIATNEREGECHLTFHAATSTHHDYMLVALRGKVVKAKVS 181
72385471  35 AHAMTLIEISGHYRRWVARGESEGWNYSNSFVVVCAVLLENIAANEREGKCHLTFHAAASMHHDYMLVALQGKVVKAKVS 114
72385459  35 AHAMTLIEISGHYHIWVARGESEDWDYSNSFVVVCVVLLENIATNEREGKCHLTFHAATSMHKNYMLVALRGKAVKAKVS 114
72385481  35 AHAMTLIEISGHYHRWVARGESEDWDYSNSFVVVCAVLLENIAANEREGKCHLTFHAATSMHHDYMLVALRGKAVKAKVS 114
84043370  35 AHAVTLIENSGHYHRWVARGESEDWDYSNGFVVVCPVPLENIAANEREGKCHLAFHAATSMHHDFMLVALRGKAVKAKVS 114
84043396  35 AHAVTLIENLGHYHRWVARGESEDWDYSNSFVVVCAVLLENIAANEREGKCHLAFHAATSMHKNYMLVALQGKVVKAKVS 114
84043402  13 AHAMTLIEISGHYHIWVARGESEDWDYSNSFVVVCVVLLENIAANEREGKCHLTFHAAASMHKNYMLVALRGKVVKAKVS 92 
72392160   1 ---MTLIEILGHYHIWVARGESEDWDYSNSFVVVCAVLLENIASNEREGKCHLTFHAATSMHKNYMLVALRGKAVKAKVS 77 
72387494  35 AHAMTLIEISGQYHRWVARGENEDWDYSNNFVVACVVLLENIATNEREGKCHLTFHAATSMHKNYMLVALQGKVVKAKVS 114
72389701  35 AHAMTLIEISSHYHRWVARGESEDWDYSNSFVVVCAVLLENIAANEREGKCHLAFHAATSMHKNYMLVALQGKVVKAKVS 114
71746148 182 FRFKEV 187
72385471 115 FRFREV 120
72385459 115 FRFKEV 120
72385481 115 FRFKEV 120
84043370 115 FRFKEM 120
84043396 115 FRFKEV 120
84043402  93 FRFKEM 98 
72392160  78 FRFKEV 83 
72387494 115 FRFREV 120
72389701 115 FRFKEV 120
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap