Conserved Protein Domain Family
PRK14544

?
PRK14544: PRK14544 
nucleoside diphosphate kinase; Provisional
Links
?
Statistics
?
PSSM-Id: 173010
View PSSM: PRK14544
Aligned: 7 rows
Threshold Bit Score: 288.635
Threshold Setting Gi: 41615096
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
119873114   1 MPIERTLVILKPDAVQRGLVGEIISRFEKAGLKIVAMKMIKATPEQIEKFYPSSEEWYRSAGSKLLKAYQELGIDPRSKI 80 
145590894   1 MPIEKTLVIIKPDAVSRGLVGEIISRFEKAGLKIVAMKMVKAAPEEVERFYPSSEEWFRSAGAKLLKAYQELGIDPKTRL 80 
126459138   1 MPVERTLVILKPDAVARRLVGEIISRFEKAGLRIVGLKMVKSSAEQIERFYPSSEEWLKSVGTKLLKAYQELGISPRERL 80 
18312716   13 MPVEKTLLILKPDAVARGLVGEIISRFEKAGLKIVALKMVKASPEEIERFYPSSEEWLRSAGQKLLKAYQELGIDPRAKI 92 
41615096    1 ---METLLMIKPDGVKRKLIGKIIERIENAGLEITDIKMLQFTREMAEQFYVFPESWYEKVGNKLIKIFEEKGLDIEQVY 77 
171185117   1 MPVEKTLVILKPDAVSRGLVGEIITRFEKAGLKIVAMKMVRATPEQMERFYPSSEDWYRSAGSKLLKAYQEIGVDPRLRI 80 
159041012   3 MAIERTLVIVKPDGVRKGLVGEVISRLERVGLKIVAMKMTWASRDKIEGFYPSSIDWFRSVGNKTLNSYREMGIDAKAEL 82 
119873114  81 GTDDPVLVGKKIKESLVKYMTSGPIVILVLKGNRAVEVVRKLVGPTSPHIAPPGTIRGDYSCDSPDLAAEEDRVVYNLVH 160
145590894  81 GTDDPVEVGKAIKRSLVKYMTSGPIVVLVLKGNRAVEVVRKIIGPTSPHSAPPGTIRGDYSTDSPDLAAEEGRVVFNLVH 160
126459138  81 GTDDPVEVGKMVKKKLVEYMTSGPIVAMVLEGNRAVEVVRKLVGPTSPHSAPPGTIRGDYSIDSPDLAAEEGRVVYNLVH 160
18312716   93 GTDDPVEVGRIIKRSLVKYMTSGPIVVMVLKGNRAVEIVRKLVGPTSPHSAPPGTIRGDYSIDSPDLAAEEGRVVFNLVH 172
41615096   78 KTRDPIEIGKKVREALIEYILSGKVVAIRIKGDKAIEKVRTLIGDTDPLKALPGTIRGDFSSDSIEVANLEGRAVYNVVH 157
171185117  81 GTDDPAEAGRLIKGRLVKYMTSGPIVVLVLKGNRAVEVVRKLVGPTSPHAAPPGTIRGDYSIDSPDLAAEEDRVVYNLVH 160
159041012  83 GTDDPVEIGKLVKKWLVDYMTESPIVLMVVEGNHAVEVVRKLVGNTLPYKAEPGTIRGDYSVDSPDLANREKRAIRNIVH 162
119873114 161 ASDSVAEAEREIRFWFREDEILD 183
145590894 161 GSDSISEAEREIKFWFRDGEVLD 183
126459138 161 ASDSASEAEREIRFWFKPEELV- 182
18312716  173 ASDSPSEAEREIRFWFREEEVLE 195
41615096  158 ASDSEENAKRELKIVFGY----- 175
171185117 161 ASDSPAEAEREIKFWFREEEILD 183
159041012 163 ASDSPEEARREIGHWFREDEIYN 185
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap