Conserved Protein Domain Family
dnaE

?
PRK07374: dnaE 
DNA polymerase III subunit alpha; Validated
Statistics
?
PSSM-Id: 168927
View PSSM: PRK07374
Aligned: 22 rows
Threshold Bit Score: 2265.39
Threshold Setting Gi: 37523503
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113955565    1 MAFVPLHNHSDYSLLDGASQLPQMVGRAKELGMPALALTDHGVMYGAVELLKLCKGAGIKPIIGNEMYVINGSIDDPQPK 80  
86604788     1 MAFVPLHLHSEYSLLDGASQLPLLIEQVVAMGLPGLALTDHGVMYGAIELVKLCKSKGIKPIIGNEMYVINGDIRD-KSR 79  
86608659     1 MSFVPLHLHSEYSLLDGASQLPRLVEQVVAMGLPGLALTDHGVMYGALELVKLCKSKGITPIIGNEMYVINGDIRD-KSR 79  
78779238     1 MGFIPLHNHSDYSLLDGASQISKIVDRACELGMDSIALTDHGVMYGVLDLVKKCKEKGIKPIIGNEMYVINGSIDDPQPK 80  
157413280    1 MGFVPLHNHSDYSLLDGASQISKIVDRASDLGMESIALTDHGVMYGVLDLVKKCKEKNIKPIIGNEMYVINGSIDDPQPK 80  
123968448    1 MAFVPLHNHSDYSLLDGASQISKIVERACDLGMDSIALTDHGVMYGVLDLVKKCKEKGIKPIIGNEMYVINGSIDDPQPK 80  
123966261    1 MGFVPLHNHSDYSLLDGASQVSKIVDRASELGMESIALTDHGVMYGVLDLVKKCKDKGIKPIIGNEMYIINGSIDDPQPK 80  
126696251    1 MAFVPLHNHSDYSLLDGASQISKIVDRACDLGMESIALTDHGVMYGVLDLVKKCKEKGIKPIIGNEMYVINGSIDDPQPK 80  
33861502     1 MGFVPLHNHSDYSLLDGASQVSKIVDRACELGMDSIALTDHGVMYGVLDLVKKCKSKGIKPIIGNEMYIINGSIDDPQPK 80  
33240201     1 MGFVPLHNHSDYSLLDGASQLPLMVARAKELGFPALALTDHGVMYGAIELLKLCKKEGIKPIIGNEMYVINGSISDPQPK 80  
113955565   81 KERRYHLVVLAKNATGYRNLVKLTSISHLRGMRGRGIFSRACVDKQLLKQYGEGLIVATACLGGEIPQAIMRDRPDVARD 160 
86604788    80 KYPKYHQVVLAKNTQGYKNLVKLTTISHLQGVQGKGIFARPCINKEYLAQYKEGLIVTSGCLAGEVPQAILQGRPEIARQ 159 
86608659    80 KYPKYHQVVLAKNTQGYKNLVKLTTISHLHGIQGKGIFSRPCINKEYLVQYKEGLIVTSGCLAGEVPQAILQRRPEIARE 159 
78779238    81 KEKRYHLVVLAKNRTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKFLLSKYSEGLIISTACLGGEIPQAILKGRLDVAED 160 
157413280   81 KEKRYHLVVLAKNYTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLSKYSDGLIVSTACLGGEIPQAILKGRLDVAED 160 
123968448   81 KEKRYHLVVLAKNYTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLSKYSDGLIVSTACLGGEIPQAILKGRLDVAED 160 
123966261   81 KEKRYHLVVLAKNHEGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLEKYKDGLIISTACLGGEIPQAILKGRIDVAEN 160 
126696251   81 KEKRYHLVVLAKNYTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLSKYSDGLIISTACLGGEIPQAILKGRLDVAED 160 
33861502    81 KEKRYHLVVLAKNHTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLEKYNDGLIISTACLGGEIPQAILKGRIDVAEN 160 
33240201    81 KEKRYHLVILAKNSTGYKNLVKLTTISHLKGMRGRGIFSRACIDKDLLKKYSEGLIISTACLGGEIPQAILRGRLDVAKE 160 
113955565  161 VALWYQQTFGDDFYLEIQDHGSPEDRIVNVEIVRIAKELGIPLIATNDAHYLTRNDVEAHDALLCVLTGKLISDVKRLRY 240 
86604788   160 VAAWYQEQFGDDYYIEIQDHGYREDRFVNVQLVRIARELGIPIILTNDSHFISCWDVEAHDALLCIQTGKSLTEKNRLRY 239 
86608659   160 VAAWYQEQFGDDYYIEIQDHGYQEDRFVNVQLVRIARELGIPIILTNDSHFISCWDVEAHDALLCIQTGKSLTEKNRLRY 239 
78779238   161 IALWYKNLFADDFYLEIQDHGSIEDRIVNIELLRIGKKHQIKVIATNDAHYLSNMDVEAHDALLCVLTGKLISDEKRLRY 240 
157413280  161 IAIWYKKIFSDDFYLEIQDHGSIEDRIVNVELIKIGKKHQIKVIATNDAHYLSNMDVEAHDALLCVLTGKLISDEKRLRY 240 
123968448  161 IALWYKKLFADDFYLEIQDHGSIEDRIVNVELIKIGKKHQIKVIATNDAHYLSSMDVEAHDALLCVLTGKLISDEKRLRY 240 
123966261  161 IACWYKNLLGEDFYLEIQDHGSMEDRIVNVEMIRIGKKYQIKVIATNDAHYISNMDVEAHDALLCVLTGKLISDEKRLRY 240 
126696251  161 IALWYKKLFADDFYLEIQDHGSIEDRIVNVELIKIGKKHQIKVIATNDAHYLSNMDVEAHDALLCVLTGKLISDEKRLRY 240 
33861502   161 TAVWYKRIFGDDFYLEIQDHGSIEDRIVNVELIRIGKEHQIKVIATNDAHYISNMDVEAHDALLCVLTGKLISDEKRLRY 240 
33240201   161 VANWYKNVFGEDFYLEIQDHGSIEDRIVNVAISKIANELNIELVATNDAHYLTENDVEAHDALLCVLTGKLVKDEKRLRY 240 
113955565  241 TGTEYLKSEEEMSRLFVDHLEPDVVAEAISNTVQVADKVEDYDILGRYQMPRFPIPEPHTPVSYLREVTEQGLRNRLEID 320 
86604788   240 SGTEYLKSPEEMRRLCRDHLEQEVIDEAIANTLKVLEKIEGYDLFGETRMPDYPVPPGHSADSYLTELAWQGLAKRCGVA 319 
86608659   240 TGTEYLKSPEEMRRLCRDHLEQEVIDEAIANTLKVLEKIEGYDLFGEMRMPDYPVPPGHSADSYLTELAWQGLAKRCGVA 319 
78779238   241 TGTEYIKSENEMLELFKDHIDDESIKEAVNNTVEISQKIEVFDLFGKYRMPKFPLNEDTDSFSLLTQLSNEGLLKRLKKN 320 
157413280  241 TGTEYIKSENEMLELFKDHIDDVSINEAVNNTVEISQKVEVFDLFGNYRMPKFPLNEDTDSFSLLTQLSNEGLLKRLKKN 320 
123968448  241 TGTEYIKSENEMLELFKDHIDDKSIIDAVNNTVEISQKVEVFDLFGNYRMPKFPLNEDKDSFSFLKQLSNKGLLKRLKKN 320 
123966261  241 TGTEYIKSEIEMLRLFNDHIDNESIKEAINNTVEVSQKIEVFDLFGTYRMPKFPLKEEKDSLSFLTKISKEGLLKRLNKA 320 
126696251  241 TGTEYIKSENEMLELFKDHIDDESIIEAVNNTVEISQKVEVFDLFGNYRMPKFPLNEDTDSFSFLTQLSNKGLLKRLKKN 320 
33861502   241 TGTEYIKSEDEMLRLFNDHIDKESIKEAINNTVEVSQKIEEFELFGTYRMPKFPLKEETDSLSFLTKITKQGLLSRLNKN 320 
33240201   241 TGTEYLKSESQMKNLFVDHLDEEVVTKAIKNTLMVASKVEEYSILGNYKMPKFPVPEGNTPIEYLESVSVNGLLEKLKLD 320 
113955565  321 SETAIDPNYGDRLSHELKIMEQMGFPTYFLVVWDYIRFAREQGIPVGPGRGSAAGSLVAYALGITNIDPVSNGLLFERFL 400 
86604788   320 YPDQIPENYQERLRFELNIIQQKGFSSYFLVVWDYVRYAREHGIPVGPGRGSAAGSLVAYALQITNIDPVKYGLLFERFL 399 
86608659   320 QPDQIPQNYQERLRFELNIIQQKGFSSYFLVVWDYVRYAREQGIPVGPGRGSAAGSLVAYALQITNIDPVKYGLLFERFL 399 
78779238   321 TLTEVDENYKKRLSSELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYALQITNIDPVEHGLLFERFL 400 
157413280  321 NFTEVDESYKKRLSTELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYSLQITNIDPVEHGLLFERFL 400 
123968448  321 DLDEVDEKYKERLTSELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYALQITNIDPVEHGLLFERFL 400 
123966261  321 NLDEVDEIYTKRLSSELKIINDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAFSLQITNIDPVKHGLLFERFL 400 
126696251  321 DLTEVDENYKKRLSSELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYALQITNIDPVEHGLLFERFL 400 
33861502   321 NLDEIDEIYKKRLTSELKIIDDMGFPDYFLVVWDYIKFARDSSIPVGPGRGSAAGSLVAYALQITNIDPVKHGLLFERFL 400 
33240201   321 SIDLIDNEYSERLSTEIKIIEEMGFPTYFLVVWDYIKFAREQSIPVGPGRGSAAGSLVAYSLGITNIDPVKNGLLFERFL 400 
113955565  401 NPERKSMPDIDTDFCIERRGEVIDYVTRRYGEDKVAQIITFNRMTSKAVLKDVARVLDIPYGDADRLAKLIPVVRGKPAK 480 
86604788   400 NPERQSMPDIDTDFCIERRGELIDYVTRKYGQERVAQIITFNRMTSKAILKDVGRVLDIPYAEADKMAKLIPVSRGKPAK 479 
86608659   400 NPERQSMPDIDTDFCIERRGELIDYVTRKYGQERVAQIITFNRMTSKAILKDVGRVLDIPYSEADKMAKLIPVSRGKPAK 479 
78779238   401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPHK 480 
157413280  401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPYK 480 
123968448  401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPYK 480 
123966261  401 NPARKSMPDIDTDFCIDRRSEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGESDKLAKLIPVVRGKPYK 480 
126696251  401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPHK 480 
33861502   401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGESDKLAKLIPVVRGKPYK 480 
33240201   401 NPERKSMPDIDTDFCIERRNEVIDYVTRMYGEDKVAQIITFNRMTSKAVLKDVARVLDIPYREADQLAKLIPVVRGKPAK 480 
113955565  481 LAAMIGEESPNPEFREKYKKDPVVKRWVDMAMRIEGTNKTYGVHAAGVVIAADPLDELVPLQRNNDGQVITQYFMEDVES 560 
86604788   480 LEEMIGENTPAPEFKEKYEKDPTTHRWIELARLLEGTNKTFGVHAAGVVISKDPLDEIVPLQYNNEGQIITQYSMEDIES 559 
86608659   480 LEEMIGEDTPAPEFKEKYEKDPTTHRWIELARLLEGTNKTFGVHAAGVVIAKDPLDEIVPLQYNNEGQIITQYSMEDIES 559 
78779238   481 LNEMIDKNSPSQEFRDKYINDNRVKKWIDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560 
157413280  481 LNEMIDKNSPSQEFRDKYINDNRVKKWVDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560 
123968448  481 LNEMIDKNSPSQEFRDKYINDNRIKKWVDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560 
123966261  481 LNEMIDKKSPSPEFRDKYLKDSKVKRWVDLALRIEGTNKTYGVHAAGVVIASESLDMLVPLQRNNEGQIITQYSMDDIES 560 
126696251  481 LNEMIDKNSPSQEFRDKYINDNRVKKWVDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560 
33861502   481 LNEMIDKKSPSPEFRDKYLKDIKVKKWIDLALRIEGTNKTYGVHAAGVVIASDPLDMLVPLQRNNEGQIITQYSMDDIES 560 
33240201   481 LDAMISKNSPSSEFRDKYEKDPLVKKWIDMAIRIEGTNKTFGVHAAGVVIASDPLDELVPLQKNNDGQVITQYFMEDIES 560 
113955565  561 MGLLKMDFLGLKNLTMIDKTLELVAATIGEKVDPDKLPLEDPETYALLARGDLEGIFQLESTGMRQIVRDLKPSSLEDIS 640 
86604788   560 LGLLKMDFLGLRNLTMIQRAVELIREHRGVTIDLDNLPLDDEKTYQLLEKGELEGIFQLESSGMKQVVRELKPSNLEDIS 639 
86608659   560 LGLLKMDFLGLRNLTMIQRAVELIREHNGVNIDLDNLPLDDKKTYQLLEKGELEGIFQLESSGMKQVVRELKPSNLEDIS 639 
78779238   561 LGLLKMDFLGLKNLTMIEKTVSLINQSTGKTINIDNLPQNDDKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640 
157413280  561 LGLLKMDFLGLKNLTMIDKTVSLINQSTGKIINVDDLPQNDSKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640 
123968448  561 LGLLKMDFLGLKNLTMIEKTVSLVNQSSGKKINIDELPRNDSKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640 
123966261  561 LGLLKMDFLGLKNLTMIDKTISLIESSTGQKINVDELPPNDNKTFDLIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640 
126696251  561 LGLLKMDFLGLKNLTMIEKTVSLINQSTGRKINIDELPQNDGKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640 
33861502   561 LGLLKMDFLGLKNLTMIDKTISLIESSTGQKINIDKLPPKDNKTFDLIGRGDLEGVFQLESSGMKQVVKDFKPNSLEDIS 640 
33240201   561 LGLLKMDFLGLKNLTMLERTVNLVEKSIGERVDLDELSLEDKKTYELLSRGDLEGIFQLESSGMRQIVRDLQPSSLEDIS 640 
113955565  641 SILALYRPGPLDAGLIPKFINRKHGRETIDFAHHSIEPILQETYGIMVYQEQIMKIAQDMAGYSLGEADLLRRAMGKKKV 720 
86604788   640 SVLALYRPGPLDTGMIPDFIDRKHGRKPVTYAHDLLKPILQDTYGAILYQEQIMRIAQDMAGYTLGQADLLRRAMGKKKV 719 
86608659   640 SVLALYRPGPLDTGMIPDFIDRKHGRKPVTYAHELLKPILQDTYGAILYQEQIMRIAQDMAGYTLGQADLLRRAMGKKKV 719 
78779238   641 SILALYRPGPLDAGLIPKFINRKNGNEKVDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720 
157413280  641 SILALYRPGPLDAGLIPKFINRKNGNEKVDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720 
123968448  641 SILALYRPGPLDAGLIPKFINRKNGNEKIDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720 
123966261  641 SILALYRPGPLDAGLIPKFINRKNGSEKIDFPHPLIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720 
126696251  641 SILALYRPGPLDAGLIPKFINRKNGNEKIDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720 
33861502   641 SILALYRPGPLDAGLIPKFINRKNGSEKIDFPHPFIESILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720 
33240201   641 SILALYRPGPLDAGLIPKFINRKHGREAIDFPHASLAPILGETYGIMIYQEQIMKIAQDLAGYSLGQADLLRRAMGKKKV 720 
113955565  721 SEMQKHRGIFVQGASDRGVDKKVADELFDQMVLFAEYCFNKSHSTAYGAVTYQTAYLKAHYPVAYMAALLTVNAGASDKV 800 
86604788   720 SEMEKHREQFVRGAVERGVAKEVATELFDQMVAFAEYCFNKSHSTAYGLITFQTAYLKANYPTEYMAALLSSVGGDQDKV 799 
86608659   720 SEMEKHREQFVQGAAKRGVSQEVATELFDQMVAFAEYCFNKSHSTAYGLITFQTAYLKANYPTEYMAALLSSVGGDQDKV 799 
78779238   721 SEMVKHRNIFVDGSMKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800 
157413280  721 SEMVKHRNIFVKGSMKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800 
123968448  721 SEMVKHRNIFVEGSMKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800 
123966261  721 SEMVKHRNIFIEGACKKGVDKKIANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHYPVAYMASLLSVNAGSSDKM 800 
126696251  721 SEMVKHRNIFVDGSRKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800 
33861502   721 SEMVKHRNIFIEGSCKKGVDKKIANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHYPVAYMASLLSVNAGSSDKM 800 
33240201   721 SEMQKHRGFFIDGAKKKGVDSKIASELFDQMVLFAEYCFNKSHSTAYGAVTYQTAYLKAHYPVAYMAALLTVNSSSTDKI 800 
113955565  801 QRYISNCNAMGIEVMPPDINASGIDFTPKGDRILFGLSAVRNLGDGAIRAVIGSRESEGAFQSLADLCDRLPSAVLNRRS 880 
86604788   800 QRYITYCLSIGIQIEPPDINRSGLDFTPQGSSILFGLGAVKNVGEGAIQNILAARQAGGPFTSLADFCQRVDLHVVNRRA 879 
86608659   800 QRYITYCLSIGIQIQPPDINRSGMDFTPQGSSILFGLGAVKNVGEGAIQNILAARQADGPFTSLADFCQRVDLRIVNRRA 879 
78779238   801 QRYISNCYSMGIEVISPSINFSGIDFTIKNNQILFGLSAIKNLGDSAIRNIIENRNNSGSFKSLSDLCDRLPSNVLNKRS 880 
157413280  801 QRYISNCYSMNIEVISPSINFSGVDFTIKNNQILFGLSAIKNLGESAIRNIIENRNSFGIFESLSDLCDRLPSNVLNKRS 880 
123968448  801 QRYISNCYSMGIEVISPSINFSGVDFTIKNNQILFGLSAIKNLGDSAIRNIIENRNSLGIFKSLADLCDRLPSNVLNKRS 880 
123966261  801 QRYISNCYSMGIEVISPSINSSGIDFTVKKDQILFGLSAIKNLGDSAIKNIIENRNKLGNFKSFSDLCDRLPSNILNKRN 880 
126696251  801 QRYISNCYSMGIEVISPSINFSGVDFTIKNNQILFGLSAIKNLGDSAIRNIIENRNSFGTFKSLSDLCDRLPSNILNKRS 880 
33861502   801 QRYISNCYSMGIEVISPSINLSGIDFTIKKDQILFGLSAIKNLGDSAIRNIIDNRNKLGVFKSFSDLCDRLPSNILNKRN 880 
33240201   801 QRYISNCNSMGIEVMPPDINSSGIDFTPLENRILFGLSAVRNLGDGVIRQLIKARVNDGLFLSLADLCDRIPSNILNRRS 880 
113955565  881 MESLIHCGAMDALEPEANRAQLMADLDLLLDWATSRAKDRASGQGNLFDLMAAassdGAEDAGTDLSLAPKAPPVKDYHP 960 
86604788   880 IESLICAGAFDGIS--GNRKQLMADLDPILNWAAEQAKSKAIGQASLFDLLGN---------DQGFIEAPRGPATEDFPP 948 
86608659   880 LEALICAGAFDCIS--GNRKQLIADLDPILSWAAQRAKSKAIGQASLFDLLG-----SSGSAGNGFVEAPRGPVTEDFPP 952 
78779238   881 IESLILCGALDEFSNNNNRAQLLSDLEHVIEWASSRNRDRLSGQGNLFD--------SKEEFSNVAFSDSQLAKVDDYSL 952 
157413280  881 LESLIHCGALDEFSNDNNRAQLLSDLEHVIDWASSRNRDRLSGQGNLFD--------SKEEFSNVAFLDTQLKKVDDYSL 952 
123968448  881 LESLIHCGALDEFSIDNNRAQLLSDLENVIEWASSRNRDRLSGQGNLFD--------SKEEFSNVAFSDSQLAKVEDYSL 952 
123966261  881 LESLIHCGALDEFSENKNRAQLFSDLDYVMEWASSRNRDRISGQGNLFD--------SISNIEHKEFSLPKGSKVDDYSL 952 
126696251  881 LESLIHCGALDEFSKDNNRAQLLSDLEHVVEWASSRNRDRLSGQGNLFD--------SKDEFSNVAFSDSQLAKVDDYSL 952 
33861502   881 LESLIHCGALDEFSENNNRAQLFSDLEYVMEWASSRNRDRISGQGNLFD--------SISKNDTKEFSLSQGSKVEDYSL 952 
33240201   881 LESLIHCGALDAFHPESNRAQLVKDLDLIIDWAGARARDRASGQGNLFDLS------SEKEEKSDISSAPQGPIVKDYHP 954 
113955565  961 TEKLRLEKDLVGFYLSDHPLKQLTPPAKLLAPIGLGSLEEQADKAKVSAIAMVSEMRQVTTRKGDRMAVLTLEDLTGSCE 1040
86604788   949 QEKLRLERELLGFYVSDHPLRRIQEQARLLAPVNLSDLSGYAADTSVGILALLTAIKTVTTKRGDRMAILQLEDLTGSCE 1028
86608659   953 QEKLRLERELLGFYVSDHPLRRIQEQARLLAPVNLADLGGCAADASVGVLALVTAIKNVTTKKGDRMAILQLEDLTGSCE 1032
78779238   953 IDKLKLEKQLLGFYLSDHPLKHLTKPAKLVSPISVSQLEETKDRTKVSLVGMIPELKQITTRKGDRMAIVQLEDLSGSCE 1032
157413280  953 IEKLKLEKQLLGFYLSDHPLKHLAKPAKLISPINISQLEETKDRTKVSLVVMIPDLKQITTRKGDRMAIVQLEDLSGSCE 1032
123968448  953 IEKLKLEKQLLGFYLSDHPLKHLTKPAKLISPISISHLEETKDRTKVSLVGMIPDLKQITTRKGDRMAIVQLEDLSGSCE 1032
123966261  953 IEKLKLEKQLLGFYLSDHPLKHLAKPAKLVSPISISQLENSHDRTKVSLVGMIPELKQITTRKGDRMAIVQLEDLSGTCE 1032
126696251  953 IEKLKLEKQLLGFYLSDHPLKHLTKPAKLVSPISISQLEEIKDRTKVSLVGMIPDLKQITTRKGDRMAIVQLEDLSGSCE 1032
33861502   953 IEKLKLEKQLLGFYLSDHPLKHLAKPAKLVSPISISQLENSHDRTKVSLVGMIPELKQITTRKGDRMAIVQLEDLSGSCE 1032
33240201   955 TEKLKLEKELLGFYLSDHPLKQLSEPAKLIAPISLINLDDQRDKSKVSVIAMIKEMRIVNTRKGDKMSILQIEDLTGSCE 1034
113955565 1041 AVVFPKSYARLADHLMAEARLLVWAAVDRRDERVQLIVDDCRAIDDLRLLMVELDPEQASDVAVQHKLRECLQAYRPDQE 1120
86604788  1029 AVIFPKTYERLRHRLEVDQRLFIWAKVDQRDEQVQLIVEDLQPIESVSWVTVELPLDSAGTLEDRYRLQTLLARQRSEAK 1108
86608659  1033 AVIFPKTYERLRGCLEVDQRLLVWAKVDQRDEQVQLIVEDLQPIESVSWVTVELPLDSAGTLEDRYRLQTLIARQRSEIK 1112
78779238  1033 AIVFPKTYVRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLIINLESSQASDVRVQNTLRDCLIKFKPDKG 1112
157413280 1033 AIVFPKTYIRLSEFLLTDTRLLLWGTIDKKSDKTQLIIDDCREIDNLKLLIINLESSQASDVRVQNTLRECLIKFKPDKD 1112
123968448 1033 AIVFPKTYVRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLIINLESSQASDVRVQNTLRNCLIKFKPDKG 1112
123966261 1033 AIVFPKTYCRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLVIDLDNSQASDIRIQNTIRDCLVKFKPDRD 1112
126696251 1033 AIVFPKTYLRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLIINLDSSQASDVRVQNILRDCLIKFKPAKD 1112
33861502  1033 AIVFPKTYCRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLVINLDSSQASDIRIQNTIRDCLVKFKPDRD 1112
33240201  1035 AVVFPKSFYRLSDHLLTETRLLFWASVDRRDEKVQLIVDDCRSIDDMRFVLIDLLPEQINKIEYQHRLRECLFKHRPGKD 1114
113955565 1121 QLGVRVPVVAAVRQGNTVRYVRLGPQFCVRDASAAALHLQEKAFKVKCSEPLLN 1174
86604788  1109 E-ENRIPVVAAIVAPPHTLWVRLGSQFWVKDAEATVAALRQAGYTARSEALASR 1161
86608659  1113 E-ENRIPVVAAITAHPHTLWVRMGSQFWVNNAQAAVEALRQAGYTARSESLLSP 1165
78779238  1113 KCGIKIPVLAAVRSKNSVTYVKFGEQFCIGDIQGACKLLENKSFHVNLKSLVS- 1165
157413280 1113 KCGIKIPVLAAVRKNNNVTYVKFGEQFCVGDIQGACKLLEDKSFQVNLKSLVS- 1165
123968448 1113 RCGIKIPVLAAVRNKNSVTYVKFGEQFCIGDIQGACKLLEDKSFKVNLKSLVS- 1165
123966261 1113 KCGIKIPVLAAVKNNESTTYVKFGDQFCVGDIVGVTKLLSDKSFQVNLKSLIA- 1165
126696251 1113 TCGIKIPVLAAVRNKNSVTYVKFGDQFCIGDIQGARKLLEDKSFQVNFKSLVS- 1165
33861502  1113 KCGIKIPVLAAVRNNDSITYVKFGDQFCVGDILGVSKLLSDKSFQVNLKSMIA- 1165
33240201  1115 ELGVKVPVVASIKGINSIRYVRLGHQFCVKDANALVESLKEISFNASCSKSLVK 1168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap