Conserved Protein Domain Family
dnaE

?
PRK07374: dnaE 
DNA polymerase III subunit alpha; Validated
Statistics
?
PSSM-Id: 168927
View PSSM: PRK07374
Aligned: 22 rows
Threshold Bit Score: 2265.39
Threshold Setting Gi: 37523503
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565    1 MAFVPLHNHSDYSLLDGASQLPQMVGRAKELGMPALALTDHGVMYGAVELLKLCKGAGIKPIIGNEMYVINGSIDDPQPK 80
gi 86604788     1 MAFVPLHLHSEYSLLDGASQLPLLIEQVVAMGLPGLALTDHGVMYGAIELVKLCKSKGIKPIIGNEMYVINGDIRD-KSR 79
gi 86608659     1 MSFVPLHLHSEYSLLDGASQLPRLVEQVVAMGLPGLALTDHGVMYGALELVKLCKSKGITPIIGNEMYVINGDIRD-KSR 79
gi 78779238     1 MGFIPLHNHSDYSLLDGASQISKIVDRACELGMDSIALTDHGVMYGVLDLVKKCKEKGIKPIIGNEMYVINGSIDDPQPK 80
gi 157413280    1 MGFVPLHNHSDYSLLDGASQISKIVDRASDLGMESIALTDHGVMYGVLDLVKKCKEKNIKPIIGNEMYVINGSIDDPQPK 80
gi 123968448    1 MAFVPLHNHSDYSLLDGASQISKIVERACDLGMDSIALTDHGVMYGVLDLVKKCKEKGIKPIIGNEMYVINGSIDDPQPK 80
gi 123966261    1 MGFVPLHNHSDYSLLDGASQVSKIVDRASELGMESIALTDHGVMYGVLDLVKKCKDKGIKPIIGNEMYIINGSIDDPQPK 80
gi 126696251    1 MAFVPLHNHSDYSLLDGASQISKIVDRACDLGMESIALTDHGVMYGVLDLVKKCKEKGIKPIIGNEMYVINGSIDDPQPK 80
gi 33861502     1 MGFVPLHNHSDYSLLDGASQVSKIVDRACELGMDSIALTDHGVMYGVLDLVKKCKSKGIKPIIGNEMYIINGSIDDPQPK 80
gi 33240201     1 MGFVPLHNHSDYSLLDGASQLPLMVARAKELGFPALALTDHGVMYGAIELLKLCKKEGIKPIIGNEMYVINGSISDPQPK 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565   81 KERRYHLVVLAKNATGYRNLVKLTSISHLRGMRGRGIFSRACVDKQLLKQYGEGLIVATACLGGEIPQAIMRDRPDVARD 160
gi 86604788    80 KYPKYHQVVLAKNTQGYKNLVKLTTISHLQGVQGKGIFARPCINKEYLAQYKEGLIVTSGCLAGEVPQAILQGRPEIARQ 159
gi 86608659    80 KYPKYHQVVLAKNTQGYKNLVKLTTISHLHGIQGKGIFSRPCINKEYLVQYKEGLIVTSGCLAGEVPQAILQRRPEIARE 159
gi 78779238    81 KEKRYHLVVLAKNRTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKFLLSKYSEGLIISTACLGGEIPQAILKGRLDVAED 160
gi 157413280   81 KEKRYHLVVLAKNYTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLSKYSDGLIVSTACLGGEIPQAILKGRLDVAED 160
gi 123968448   81 KEKRYHLVVLAKNYTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLSKYSDGLIVSTACLGGEIPQAILKGRLDVAED 160
gi 123966261   81 KEKRYHLVVLAKNHEGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLEKYKDGLIISTACLGGEIPQAILKGRIDVAEN 160
gi 126696251   81 KEKRYHLVVLAKNYTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLSKYSDGLIISTACLGGEIPQAILKGRLDVAED 160
gi 33861502    81 KEKRYHLVVLAKNHTGYKNLVKLTTISHLNGMRGRGIFSRPCIDKSLLEKYNDGLIISTACLGGEIPQAILKGRIDVAEN 160
gi 33240201    81 KEKRYHLVILAKNSTGYKNLVKLTTISHLKGMRGRGIFSRACIDKDLLKKYSEGLIISTACLGGEIPQAILRGRLDVAKE 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  161 VALWYQQTFGDDFYLEIQDHGSPEDRIVNVEIVRIAKELGIPLIATNDAHYLTRNDVEAHDALLCVLTGKLISDVKRLRY 240
gi 86604788   160 VAAWYQEQFGDDYYIEIQDHGYREDRFVNVQLVRIARELGIPIILTNDSHFISCWDVEAHDALLCIQTGKSLTEKNRLRY 239
gi 86608659   160 VAAWYQEQFGDDYYIEIQDHGYQEDRFVNVQLVRIARELGIPIILTNDSHFISCWDVEAHDALLCIQTGKSLTEKNRLRY 239
gi 78779238   161 IALWYKNLFADDFYLEIQDHGSIEDRIVNIELLRIGKKHQIKVIATNDAHYLSNMDVEAHDALLCVLTGKLISDEKRLRY 240
gi 157413280  161 IAIWYKKIFSDDFYLEIQDHGSIEDRIVNVELIKIGKKHQIKVIATNDAHYLSNMDVEAHDALLCVLTGKLISDEKRLRY 240
gi 123968448  161 IALWYKKLFADDFYLEIQDHGSIEDRIVNVELIKIGKKHQIKVIATNDAHYLSSMDVEAHDALLCVLTGKLISDEKRLRY 240
gi 123966261  161 IACWYKNLLGEDFYLEIQDHGSMEDRIVNVEMIRIGKKYQIKVIATNDAHYISNMDVEAHDALLCVLTGKLISDEKRLRY 240
gi 126696251  161 IALWYKKLFADDFYLEIQDHGSIEDRIVNVELIKIGKKHQIKVIATNDAHYLSNMDVEAHDALLCVLTGKLISDEKRLRY 240
gi 33861502   161 TAVWYKRIFGDDFYLEIQDHGSIEDRIVNVELIRIGKEHQIKVIATNDAHYISNMDVEAHDALLCVLTGKLISDEKRLRY 240
gi 33240201   161 VANWYKNVFGEDFYLEIQDHGSIEDRIVNVAISKIANELNIELVATNDAHYLTENDVEAHDALLCVLTGKLVKDEKRLRY 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  241 TGTEYLKSEEEMSRLFVDHLEPDVVAEAISNTVQVADKVEDYDILGRYQMPRFPIPEPHTPVSYLREVTEQGLRNRLEID 320
gi 86604788   240 SGTEYLKSPEEMRRLCRDHLEQEVIDEAIANTLKVLEKIEGYDLFGETRMPDYPVPPGHSADSYLTELAWQGLAKRCGVA 319
gi 86608659   240 TGTEYLKSPEEMRRLCRDHLEQEVIDEAIANTLKVLEKIEGYDLFGEMRMPDYPVPPGHSADSYLTELAWQGLAKRCGVA 319
gi 78779238   241 TGTEYIKSENEMLELFKDHIDDESIKEAVNNTVEISQKIEVFDLFGKYRMPKFPLNEDTDSFSLLTQLSNEGLLKRLKKN 320
gi 157413280  241 TGTEYIKSENEMLELFKDHIDDVSINEAVNNTVEISQKVEVFDLFGNYRMPKFPLNEDTDSFSLLTQLSNEGLLKRLKKN 320
gi 123968448  241 TGTEYIKSENEMLELFKDHIDDKSIIDAVNNTVEISQKVEVFDLFGNYRMPKFPLNEDKDSFSFLKQLSNKGLLKRLKKN 320
gi 123966261  241 TGTEYIKSEIEMLRLFNDHIDNESIKEAINNTVEVSQKIEVFDLFGTYRMPKFPLKEEKDSLSFLTKISKEGLLKRLNKA 320
gi 126696251  241 TGTEYIKSENEMLELFKDHIDDESIIEAVNNTVEISQKVEVFDLFGNYRMPKFPLNEDTDSFSFLTQLSNKGLLKRLKKN 320
gi 33861502   241 TGTEYIKSEDEMLRLFNDHIDKESIKEAINNTVEVSQKIEEFELFGTYRMPKFPLKEETDSLSFLTKITKQGLLSRLNKN 320
gi 33240201   241 TGTEYLKSESQMKNLFVDHLDEEVVTKAIKNTLMVASKVEEYSILGNYKMPKFPVPEGNTPIEYLESVSVNGLLEKLKLD 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  321 SETAIDPNYGDRLSHELKIMEQMGFPTYFLVVWDYIRFAREQGIPVGPGRGSAAGSLVAYALGITNIDPVSNGLLFERFL 400
gi 86604788   320 YPDQIPENYQERLRFELNIIQQKGFSSYFLVVWDYVRYAREHGIPVGPGRGSAAGSLVAYALQITNIDPVKYGLLFERFL 399
gi 86608659   320 QPDQIPQNYQERLRFELNIIQQKGFSSYFLVVWDYVRYAREQGIPVGPGRGSAAGSLVAYALQITNIDPVKYGLLFERFL 399
gi 78779238   321 TLTEVDENYKKRLSSELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYALQITNIDPVEHGLLFERFL 400
gi 157413280  321 NFTEVDESYKKRLSTELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYSLQITNIDPVEHGLLFERFL 400
gi 123968448  321 DLDEVDEKYKERLTSELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYALQITNIDPVEHGLLFERFL 400
gi 123966261  321 NLDEVDEIYTKRLSSELKIINDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAFSLQITNIDPVKHGLLFERFL 400
gi 126696251  321 DLTEVDENYKKRLSSELKIIKDMGFPDYFLVVWDYIKFARDNSIPVGPGRGSAAGSLVAYALQITNIDPVEHGLLFERFL 400
gi 33861502   321 NLDEIDEIYKKRLTSELKIIDDMGFPDYFLVVWDYIKFARDSSIPVGPGRGSAAGSLVAYALQITNIDPVKHGLLFERFL 400
gi 33240201   321 SIDLIDNEYSERLSTEIKIIEEMGFPTYFLVVWDYIKFAREQSIPVGPGRGSAAGSLVAYSLGITNIDPVKNGLLFERFL 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  401 NPERKSMPDIDTDFCIERRGEVIDYVTRRYGEDKVAQIITFNRMTSKAVLKDVARVLDIPYGDADRLAKLIPVVRGKPAK 480
gi 86604788   400 NPERQSMPDIDTDFCIERRGELIDYVTRKYGQERVAQIITFNRMTSKAILKDVGRVLDIPYAEADKMAKLIPVSRGKPAK 479
gi 86608659   400 NPERQSMPDIDTDFCIERRGELIDYVTRKYGQERVAQIITFNRMTSKAILKDVGRVLDIPYSEADKMAKLIPVSRGKPAK 479
gi 78779238   401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPHK 480
gi 157413280  401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPYK 480
gi 123968448  401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPYK 480
gi 123966261  401 NPARKSMPDIDTDFCIDRRSEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGESDKLAKLIPVVRGKPYK 480
gi 126696251  401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGEADKLAKLIPVVRGKPHK 480
gi 33861502   401 NPARKSMPDIDTDFCIDRRNEVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGESDKLAKLIPVVRGKPYK 480
gi 33240201   401 NPERKSMPDIDTDFCIERRNEVIDYVTRMYGEDKVAQIITFNRMTSKAVLKDVARVLDIPYREADQLAKLIPVVRGKPAK 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  481 LAAMIGEESPNPEFREKYKKDPVVKRWVDMAMRIEGTNKTYGVHAAGVVIAADPLDELVPLQRNNDGQVITQYFMEDVES 560
gi 86604788   480 LEEMIGENTPAPEFKEKYEKDPTTHRWIELARLLEGTNKTFGVHAAGVVISKDPLDEIVPLQYNNEGQIITQYSMEDIES 559
gi 86608659   480 LEEMIGEDTPAPEFKEKYEKDPTTHRWIELARLLEGTNKTFGVHAAGVVIAKDPLDEIVPLQYNNEGQIITQYSMEDIES 559
gi 78779238   481 LNEMIDKNSPSQEFRDKYINDNRVKKWIDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560
gi 157413280  481 LNEMIDKNSPSQEFRDKYINDNRVKKWVDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560
gi 123968448  481 LNEMIDKNSPSQEFRDKYINDNRIKKWVDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560
gi 123966261  481 LNEMIDKKSPSPEFRDKYLKDSKVKRWVDLALRIEGTNKTYGVHAAGVVIASESLDMLVPLQRNNEGQIITQYSMDDIES 560
gi 126696251  481 LNEMIDKNSPSQEFRDKYINDNRVKKWVDLALRIEGTNKTYGVHAAGVVIASDPLDELVPLQRNNEGQIITQYSMDDIES 560
gi 33861502   481 LNEMIDKKSPSPEFRDKYLKDIKVKKWIDLALRIEGTNKTYGVHAAGVVIASDPLDMLVPLQRNNEGQIITQYSMDDIES 560
gi 33240201   481 LDAMISKNSPSSEFRDKYEKDPLVKKWIDMAIRIEGTNKTFGVHAAGVVIASDPLDELVPLQKNNDGQVITQYFMEDIES 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  561 MGLLKMDFLGLKNLTMIDKTLELVAATIGEKVDPDKLPLEDPETYALLARGDLEGIFQLESTGMRQIVRDLKPSSLEDIS 640
gi 86604788   560 LGLLKMDFLGLRNLTMIQRAVELIREHRGVTIDLDNLPLDDEKTYQLLEKGELEGIFQLESSGMKQVVRELKPSNLEDIS 639
gi 86608659   560 LGLLKMDFLGLRNLTMIQRAVELIREHNGVNIDLDNLPLDDKKTYQLLEKGELEGIFQLESSGMKQVVRELKPSNLEDIS 639
gi 78779238   561 LGLLKMDFLGLKNLTMIEKTVSLINQSTGKTINIDNLPQNDDKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640
gi 157413280  561 LGLLKMDFLGLKNLTMIDKTVSLINQSTGKIINVDDLPQNDSKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640
gi 123968448  561 LGLLKMDFLGLKNLTMIEKTVSLVNQSSGKKINIDELPRNDSKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640
gi 123966261  561 LGLLKMDFLGLKNLTMIDKTISLIESSTGQKINVDELPPNDNKTFDLIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640
gi 126696251  561 LGLLKMDFLGLKNLTMIEKTVSLINQSTGRKINIDELPQNDGKTFELIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDIS 640
gi 33861502   561 LGLLKMDFLGLKNLTMIDKTISLIESSTGQKINIDKLPPKDNKTFDLIGRGDLEGVFQLESSGMKQVVKDFKPNSLEDIS 640
gi 33240201   561 LGLLKMDFLGLKNLTMLERTVNLVEKSIGERVDLDELSLEDKKTYELLSRGDLEGIFQLESSGMRQIVRDLQPSSLEDIS 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  641 SILALYRPGPLDAGLIPKFINRKHGRETIDFAHHSIEPILQETYGIMVYQEQIMKIAQDMAGYSLGEADLLRRAMGKKKV 720
gi 86604788   640 SVLALYRPGPLDTGMIPDFIDRKHGRKPVTYAHDLLKPILQDTYGAILYQEQIMRIAQDMAGYTLGQADLLRRAMGKKKV 719
gi 86608659   640 SVLALYRPGPLDTGMIPDFIDRKHGRKPVTYAHELLKPILQDTYGAILYQEQIMRIAQDMAGYTLGQADLLRRAMGKKKV 719
gi 78779238   641 SILALYRPGPLDAGLIPKFINRKNGNEKVDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720
gi 157413280  641 SILALYRPGPLDAGLIPKFINRKNGNEKVDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720
gi 123968448  641 SILALYRPGPLDAGLIPKFINRKNGNEKIDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720
gi 123966261  641 SILALYRPGPLDAGLIPKFINRKNGSEKIDFPHPLIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720
gi 126696251  641 SILALYRPGPLDAGLIPKFINRKNGNEKIDFPHPFIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720
gi 33861502   641 SILALYRPGPLDAGLIPKFINRKNGSEKIDFPHPFIESILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV 720
gi 33240201   641 SILALYRPGPLDAGLIPKFINRKHGREAIDFPHASLAPILGETYGIMIYQEQIMKIAQDLAGYSLGQADLLRRAMGKKKV 720
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  721 SEMQKHRGIFVQGASDRGVDKKVADELFDQMVLFAEYCFNKSHSTAYGAVTYQTAYLKAHYPVAYMAALLTVNAGASDKV 800
gi 86604788   720 SEMEKHREQFVRGAVERGVAKEVATELFDQMVAFAEYCFNKSHSTAYGLITFQTAYLKANYPTEYMAALLSSVGGDQDKV 799
gi 86608659   720 SEMEKHREQFVQGAAKRGVSQEVATELFDQMVAFAEYCFNKSHSTAYGLITFQTAYLKANYPTEYMAALLSSVGGDQDKV 799
gi 78779238   721 SEMVKHRNIFVDGSMKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800
gi 157413280  721 SEMVKHRNIFVKGSMKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800
gi 123968448  721 SEMVKHRNIFVEGSMKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800
gi 123966261  721 SEMVKHRNIFIEGACKKGVDKKIANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHYPVAYMASLLSVNAGSSDKM 800
gi 126696251  721 SEMVKHRNIFVDGSRKKGVNEKLANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHFPVAYMAALLSVNSGSSDKM 800
gi 33861502   721 SEMVKHRNIFIEGSCKKGVDKKIANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAHYPVAYMASLLSVNAGSSDKM 800
gi 33240201   721 SEMQKHRGFFIDGAKKKGVDSKIASELFDQMVLFAEYCFNKSHSTAYGAVTYQTAYLKAHYPVAYMAALLTVNSSSTDKI 800
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  801 QRYISNCNAMGIEVMPPDINASGIDFTPKGDRILFGLSAVRNLGDGAIRAVIGSRESEGAFQSLADLCDRLPSAVLNRRS 880
gi 86604788   800 QRYITYCLSIGIQIEPPDINRSGLDFTPQGSSILFGLGAVKNVGEGAIQNILAARQAGGPFTSLADFCQRVDLHVVNRRA 879
gi 86608659   800 QRYITYCLSIGIQIQPPDINRSGMDFTPQGSSILFGLGAVKNVGEGAIQNILAARQADGPFTSLADFCQRVDLRIVNRRA 879
gi 78779238   801 QRYISNCYSMGIEVISPSINFSGIDFTIKNNQILFGLSAIKNLGDSAIRNIIENRNNSGSFKSLSDLCDRLPSNVLNKRS 880
gi 157413280  801 QRYISNCYSMNIEVISPSINFSGVDFTIKNNQILFGLSAIKNLGESAIRNIIENRNSFGIFESLSDLCDRLPSNVLNKRS 880
gi 123968448  801 QRYISNCYSMGIEVISPSINFSGVDFTIKNNQILFGLSAIKNLGDSAIRNIIENRNSLGIFKSLADLCDRLPSNVLNKRS 880
gi 123966261  801 QRYISNCYSMGIEVISPSINSSGIDFTVKKDQILFGLSAIKNLGDSAIKNIIENRNKLGNFKSFSDLCDRLPSNILNKRN 880
gi 126696251  801 QRYISNCYSMGIEVISPSINFSGVDFTIKNNQILFGLSAIKNLGDSAIRNIIENRNSFGTFKSLSDLCDRLPSNILNKRS 880
gi 33861502   801 QRYISNCYSMGIEVISPSINLSGIDFTIKKDQILFGLSAIKNLGDSAIRNIIDNRNKLGVFKSFSDLCDRLPSNILNKRN 880
gi 33240201   801 QRYISNCNSMGIEVMPPDINSSGIDFTPLENRILFGLSAVRNLGDGVIRQLIKARVNDGLFLSLADLCDRIPSNILNRRS 880
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  881 MESLIHCGAMDALEPEANRAQLMADLDLLLDWATSRAKDRASGQGNLFDLMAAassdGAEDAGTDLSLAPKAPPVKDYHP 960
gi 86604788   880 IESLICAGAFDGIS--GNRKQLMADLDPILNWAAEQAKSKAIGQASLFDLLGN---------DQGFIEAPRGPATEDFPP 948
gi 86608659   880 LEALICAGAFDCIS--GNRKQLIADLDPILSWAAQRAKSKAIGQASLFDLLG-----SSGSAGNGFVEAPRGPVTEDFPP 952
gi 78779238   881 IESLILCGALDEFSNNNNRAQLLSDLEHVIEWASSRNRDRLSGQGNLFD--------SKEEFSNVAFSDSQLAKVDDYSL 952
gi 157413280  881 LESLIHCGALDEFSNDNNRAQLLSDLEHVIDWASSRNRDRLSGQGNLFD--------SKEEFSNVAFLDTQLKKVDDYSL 952
gi 123968448  881 LESLIHCGALDEFSIDNNRAQLLSDLENVIEWASSRNRDRLSGQGNLFD--------SKEEFSNVAFSDSQLAKVEDYSL 952
gi 123966261  881 LESLIHCGALDEFSENKNRAQLFSDLDYVMEWASSRNRDRISGQGNLFD--------SISNIEHKEFSLPKGSKVDDYSL 952
gi 126696251  881 LESLIHCGALDEFSKDNNRAQLLSDLEHVVEWASSRNRDRLSGQGNLFD--------SKDEFSNVAFSDSQLAKVDDYSL 952
gi 33861502   881 LESLIHCGALDEFSENNNRAQLFSDLEYVMEWASSRNRDRISGQGNLFD--------SISKNDTKEFSLSQGSKVEDYSL 952
gi 33240201   881 LESLIHCGALDAFHPESNRAQLVKDLDLIIDWAGARARDRASGQGNLFDLS------SEKEEKSDISSAPQGPIVKDYHP 954
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565  961 TEKLRLEKDLVGFYLSDHPLKQLTPPAKLLAPIGLGSLEEQADKAKVSAIAMVSEMRQVTTRKGDRMAVLTLEDLTGSCE 1040
gi 86604788   949 QEKLRLERELLGFYVSDHPLRRIQEQARLLAPVNLSDLSGYAADTSVGILALLTAIKTVTTKRGDRMAILQLEDLTGSCE 1028
gi 86608659   953 QEKLRLERELLGFYVSDHPLRRIQEQARLLAPVNLADLGGCAADASVGVLALVTAIKNVTTKKGDRMAILQLEDLTGSCE 1032
gi 78779238   953 IDKLKLEKQLLGFYLSDHPLKHLTKPAKLVSPISVSQLEETKDRTKVSLVGMIPELKQITTRKGDRMAIVQLEDLSGSCE 1032
gi 157413280  953 IEKLKLEKQLLGFYLSDHPLKHLAKPAKLISPINISQLEETKDRTKVSLVVMIPDLKQITTRKGDRMAIVQLEDLSGSCE 1032
gi 123968448  953 IEKLKLEKQLLGFYLSDHPLKHLTKPAKLISPISISHLEETKDRTKVSLVGMIPDLKQITTRKGDRMAIVQLEDLSGSCE 1032
gi 123966261  953 IEKLKLEKQLLGFYLSDHPLKHLAKPAKLVSPISISQLENSHDRTKVSLVGMIPELKQITTRKGDRMAIVQLEDLSGTCE 1032
gi 126696251  953 IEKLKLEKQLLGFYLSDHPLKHLTKPAKLVSPISISQLEEIKDRTKVSLVGMIPDLKQITTRKGDRMAIVQLEDLSGSCE 1032
gi 33861502   953 IEKLKLEKQLLGFYLSDHPLKHLAKPAKLVSPISISQLENSHDRTKVSLVGMIPELKQITTRKGDRMAIVQLEDLSGSCE 1032
gi 33240201   955 TEKLKLEKELLGFYLSDHPLKQLSEPAKLIAPISLINLDDQRDKSKVSVIAMIKEMRIVNTRKGDKMSILQIEDLTGSCE 1034
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 113955565 1041 AVVFPKSYARLADHLMAEARLLVWAAVDRRDERVQLIVDDCRAIDDLRLLMVELDPEQASDVAVQHKLRECLQAYRPDQE 1120
gi 86604788  1029 AVIFPKTYERLRHRLEVDQRLFIWAKVDQRDEQVQLIVEDLQPIESVSWVTVELPLDSAGTLEDRYRLQTLLARQRSEAK 1108
gi 86608659  1033 AVIFPKTYERLRGCLEVDQRLLVWAKVDQRDEQVQLIVEDLQPIESVSWVTVELPLDSAGTLEDRYRLQTLIARQRSEIK 1112
gi 78779238  1033 AIVFPKTYVRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLIINLESSQASDVRVQNTLRDCLIKFKPDKG 1112
gi 157413280 1033 AIVFPKTYIRLSEFLLTDTRLLLWGTIDKKSDKTQLIIDDCREIDNLKLLIINLESSQASDVRVQNTLRECLIKFKPDKD 1112
gi 123968448 1033 AIVFPKTYVRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLIINLESSQASDVRVQNTLRNCLIKFKPDKG 1112
gi 123966261 1033 AIVFPKTYCRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLVIDLDNSQASDIRIQNTIRDCLVKFKPDRD 1112
gi 126696251 1033 AIVFPKTYLRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLIINLDSSQASDVRVQNILRDCLIKFKPAKD 1112
gi 33861502  1033 AIVFPKTYCRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLKLLVINLDSSQASDIRIQNTIRDCLVKFKPDRD 1112
gi 33240201  1035 AVVFPKSFYRLSDHLLTETRLLFWASVDRRDEKVQLIVDDCRSIDDMRFVLIDLLPEQINKIEYQHRLRECLFKHRPGKD 1114
                        1130      1140      1150      1160      1170
                  ....*....|....*....|....*....|....*....|....*....|....
gi 113955565 1121 QLGVRVPVVAAVRQGNTVRYVRLGPQFCVRDASAAALHLQEKAFKVKCSEPLLN 1174
gi 86604788  1109 E-ENRIPVVAAIVAPPHTLWVRLGSQFWVKDAEATVAALRQAGYTARSEALASR 1161
gi 86608659  1113 E-ENRIPVVAAITAHPHTLWVRMGSQFWVNNAQAAVEALRQAGYTARSESLLSP 1165
gi 78779238  1113 KCGIKIPVLAAVRSKNSVTYVKFGEQFCIGDIQGACKLLENKSFHVNLKSLVS- 1165
gi 157413280 1113 KCGIKIPVLAAVRKNNNVTYVKFGEQFCVGDIQGACKLLEDKSFQVNLKSLVS- 1165
gi 123968448 1113 RCGIKIPVLAAVRNKNSVTYVKFGEQFCIGDIQGACKLLEDKSFKVNLKSLVS- 1165
gi 123966261 1113 KCGIKIPVLAAVKNNESTTYVKFGDQFCVGDIVGVTKLLSDKSFQVNLKSLIA- 1165
gi 126696251 1113 TCGIKIPVLAAVRNKNSVTYVKFGDQFCIGDIQGARKLLEDKSFQVNFKSLVS- 1165
gi 33861502  1113 KCGIKIPVLAAVRNNDSITYVKFGDQFCVGDILGVSKLLSDKSFQVNLKSMIA- 1165
gi 33240201  1115 ELGVKVPVVASIKGINSIRYVRLGHQFCVKDANALVESLKEISFNASCSKSLVK 1168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap