Conserved Protein Domain Family
PRK06749

?
PRK06749: PRK06749 
replicative DNA helicase; Provisional
Statistics
?
PSSM-Id: 168658
View PSSM: PRK06749
Aligned: 24 rows
Threshold Bit Score: 739.455
Threshold Setting Gi: 222094683
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
30261063    1 MSIQNVEAEKTVLGSLLLDGELIKECRLTEQYFSMPVHKSIFQLMRKMEGEGQPIDLVTFTSRVDPNFLKGIGGMEYFIG 80 
30019111    4 MSIQNVEAEKTVLGSLLIDGELIKECRLTEQYFSMPVHKSIFQLMRKMESERQPIDLVTFISRVDPKFLEGIGGMEYFIG 83 
218895995   1 MSIQNVEAEKTVLGSLLIDGELIKECRLTEQYFSMPVHKSIFQLMRKMEGEGQPIDLVTFISRVDPKFLEGIGGMEYFIG 80 
218898940   1 -MIRNVEAEQSVLGSIIQEGDLIKDCQLKVKQFSLPTHQVIFKAMRELEDAEVPIDLVALIGKFDESFMHQIGGIEFFVN 79 
217958097   1 -MIRNVEAEQSVLGSIIQEGDLIKDCQLKAKQFSLPTHQMIFKAMRELEDAEAPIDLVALIGKFDEGFMHQIGGIEFFVN 79 
218901701   4 DMIRNVEAEQSVLGSIIQEGDLIKDCQLKAKQFSLPTHQMIFKAMRELEDDEAPIDLVALIGKFDESFMHQIGGIEFFVN 83 
218902142   1 MSIQNVEAEKTVLGSLLLDGELIKECRLTEQYFSMPVHKSIFQLMRKMEEEGQPIDLVTFISRVDPKFLEGIGGMEYFIG 80 
225862892   1 MSIQNVEAEKTVLGSLLIDGELIKECRLTEQYFSLSVHKSIFQLMRKMEEEGQPIDLVTFISRVDPKFLEGIGGMEYFIG 80 
163938835   1 MSIQNVEAEKTVLGSLLIDGELIKECRLTEHYFSMPVHKSIFRLMRKIEDEGQPIDLVTLVSRMNPNFLENIGGMEYFIA 80 
163941526   4 DMIRNTEAEQSVLGSIIQEGDLIKDCQLKEKQFSLPTHQVIFKAMRELEDAEVPIDLVALMGKFDESFMNQIGGIEFFVN 83 
30261063   81 LMDGVPTTSNFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKSEKIIGETITALCELEEKDCVCEFDLKDALVDLYEELH 160
30019111   84 LMDGVPTTSNFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKNEEIIGETITALCELEEKDSVCEFDLKDALVDLYEELH 163
218895995  81 LMDGVPTTSNFSYYEGLVRGAWKMYQAGVIGHRMGERLIAEKSEKVIGETITALCELEEKDCVCEFDLKDALVDLYEELH 160
218898940  80 LTEVVTTTKNFSYHEGLVIEAWKMRHAQEVAGNLYNRLQQDRDMSAISISIDELSAIEETGYSDEFNLKDTLVDLYKNMQ 159
217958097  80 LTEVVTTTKNFSYHEGLVIEAWKMRHAQEVAGNLYNRLQQDRDISVIGASIDELSAIEETGYSDEFNLKETLVDLYKKMQ 159
218901701  84 LTEVVTTTKNFSYHEGLVIEAWKMRHAQDVAGNLYNRLQQDRDISVISASIDELSAIEETGYSDEFNLKETLVDLYKKMQ 163
218902142  81 LMDGVPTTRNFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKNEEIIGETITALCELEEQDCVCEFDLKDALVDLYEELH 160
225862892  81 LMDGVPTTANFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKNEKIIGETITALCELEEKDCVCEFDLKDALVDLYEELH 160
163938835  81 LIEGVPTTANFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKDEKIIGETVTELCELEEKDCVCEFDLKDALVGLYEELH 160
163941526  84 LTEVVTTTKNFSYHEGLVIEAWKMRHAQEVAGNLYNRLQHERDMSAISTSIDELSAIEETGYSDEFNLKETLVDLYKNMQ 163
30261063  161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
30019111  164 QDVKEITGIESGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 243
218895995 161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGSAVGLFSLEMSSKQLLKRMASCVSEV 240
218898940 160 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIVGARPSMGKTAFVLNVAFHAASAHTATGIFSLEMGEEQLLKRMISSTGNI 239
217958097 160 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIVGARPSMGKTAFVLNVAFHAASAQTATGFFSLEMGEEQLLKRMISSTGNI 239
218901701 164 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIVGARPSMGKTAFVLNVAFHAASAQTATGFFSLEMGEEQLLKRMISSTGNI 243
218902142 161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
225862892 161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
163938835 161 QDTKENTGIETGYISLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
163941526 164 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIIGARPSMGKTAFVLNIAFHAASAHTATGVFSLEMGEEQLLKRMISSTGNI 243
30261063  241 SGGRLKNPKHRFAIEDWERVSKAFAEIGELPLEIYDHAGVTVQDIWMQTRKLKRKHGDKKILIIVDYLQLITGDPKHKGN 320
30019111  244 SGGRLKNPKHRFAMEDWEKVSKAFAEIGELPLEIYDNAGVTVQDIWMQTRKLKRKHGDNKILIIVDYLQLITGDPKHKGN 323
218895995 241 SGGRLKNPKHRFAIEDWEKVSKAFAEIGKLPLEIYDNAGISVQDIWMQTRKLKRKHGDKKVLVIVDYLQLITGDPKHKGN 320
218898940 240 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKARKLKRKYPDKKVLIAIDYLQLIVGDLKHRGN 319
217958097 240 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKTRKLKRKYPEKKVLVAIDYLQLIVGDPKHKGN 319
218901701 244 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKTRKLKRKYPEKKVLVAIDYLQLIVGDPKHKGN 323
218902142 241 SGGRLKNPKHRFAMEDWEKVSKAFAEIGELPLEIYDNAGVTVQDIWMQTRKLKRKHGDKKILMIVDYLQLITGDPKHKGN 320
225862892 241 SGGRLKNPKHRFAIEDWEKVSKAFAEIGELPLEIYDNAGISVQDIWMQTRKLKRKHEDKKILVIVDYLQLITGDPKHKGN 320
163938835 241 SGGRLKNPKHRFAMEDWEKVSKAFAEIGELPLEIYDNAGVMVQDIWMQTRKLKRKHGDKKLLVIVDYLQLITGDPKHKGN 320
163941526 244 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKTRKLKRKYPDKKVLVAIDYLQLIVGDSKHRGN 323
30261063  321 RFQEISEISRKLKLLARELNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETMQKEMTEI 400
30019111  324 RFQEISEISRKLKLLARELNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETMQKEMTEI 403
218895995 321 RFQEISEISRKLKLLARELNVCVVALSQLSRSVEARQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETVQKEMTEI 400
218898940 320 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 399
217958097 320 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 399
218901701 324 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 403
218902142 321 RFQEISEISRKLKLLARELNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETKQKEMTEI 400
225862892 321 RFQEISEISRKLKVLARELNVCVVALSQLSRSVEARQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETVQKEMTEI 400
163938835 321 RFQEISEISRKLKLLARDLNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETMQKEMTEI 400
163941526 324 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 403
30261063  401 HVAKHRNGPVGSFKLRFMKEFGRFVEGG 428
30019111  404 HVAKHRNGPVGSFKLRFLKEFGRFVEIG 431
218895995 401 HVAKHRNGPVGSFKLRFLKEFGQFVEGV 428
218898940 400 ILAKQRNGPVGVVELAFIKEFSKFVNLE 427
217958097 400 ILAKQRNGPVGVVELAFIKEFSKFVGLE 427
218901701 404 ILAKQRNGPVGVVELAFIKEFSKFVGLE 431
218902142 401 HVAKHRNGPVGSFKLRFMKEFGRFVEGK 428
225862892 401 HVAKHRNGPVGSFKLRFLKEFGRFVEVG 428
163938835 401 HVAKHRNGPVGSFKLRFLKEFGRFVEMV 428
163941526 404 ILAKQRNGPVGVVELAFIKEFSKFVNLE 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap