Conserved Protein Domain Family
PRK06749

?
PRK06749: PRK06749 
replicative DNA helicase; Provisional
Statistics
?
PSSM-Id: 168658
View PSSM: PRK06749
Aligned: 24 rows
Threshold Bit Score: 739.455
Threshold Setting Gi: 222094683
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261063    1 MSIQNVEAEKTVLGSLLLDGELIKECRLTEQYFSMPVHKSIFQLMRKMEGEGQPIDLVTFTSRVDPNFLKGIGGMEYFIG 80
gi 30019111    4 MSIQNVEAEKTVLGSLLIDGELIKECRLTEQYFSMPVHKSIFQLMRKMESERQPIDLVTFISRVDPKFLEGIGGMEYFIG 83
gi 218895995   1 MSIQNVEAEKTVLGSLLIDGELIKECRLTEQYFSMPVHKSIFQLMRKMEGEGQPIDLVTFISRVDPKFLEGIGGMEYFIG 80
gi 218898940   1 -MIRNVEAEQSVLGSIIQEGDLIKDCQLKVKQFSLPTHQVIFKAMRELEDAEVPIDLVALIGKFDESFMHQIGGIEFFVN 79
gi 217958097   1 -MIRNVEAEQSVLGSIIQEGDLIKDCQLKAKQFSLPTHQMIFKAMRELEDAEAPIDLVALIGKFDEGFMHQIGGIEFFVN 79
gi 218901701   4 DMIRNVEAEQSVLGSIIQEGDLIKDCQLKAKQFSLPTHQMIFKAMRELEDDEAPIDLVALIGKFDESFMHQIGGIEFFVN 83
gi 218902142   1 MSIQNVEAEKTVLGSLLLDGELIKECRLTEQYFSMPVHKSIFQLMRKMEEEGQPIDLVTFISRVDPKFLEGIGGMEYFIG 80
gi 225862892   1 MSIQNVEAEKTVLGSLLIDGELIKECRLTEQYFSLSVHKSIFQLMRKMEEEGQPIDLVTFISRVDPKFLEGIGGMEYFIG 80
gi 163938835   1 MSIQNVEAEKTVLGSLLIDGELIKECRLTEHYFSMPVHKSIFRLMRKIEDEGQPIDLVTLVSRMNPNFLENIGGMEYFIA 80
gi 163941526   4 DMIRNTEAEQSVLGSIIQEGDLIKDCQLKEKQFSLPTHQVIFKAMRELEDAEVPIDLVALMGKFDESFMNQIGGIEFFVN 83
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261063   81 LMDGVPTTSNFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKSEKIIGETITALCELEEKDCVCEFDLKDALVDLYEELH 160
gi 30019111   84 LMDGVPTTSNFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKNEEIIGETITALCELEEKDSVCEFDLKDALVDLYEELH 163
gi 218895995  81 LMDGVPTTSNFSYYEGLVRGAWKMYQAGVIGHRMGERLIAEKSEKVIGETITALCELEEKDCVCEFDLKDALVDLYEELH 160
gi 218898940  80 LTEVVTTTKNFSYHEGLVIEAWKMRHAQEVAGNLYNRLQQDRDMSAISISIDELSAIEETGYSDEFNLKDTLVDLYKNMQ 159
gi 217958097  80 LTEVVTTTKNFSYHEGLVIEAWKMRHAQEVAGNLYNRLQQDRDISVIGASIDELSAIEETGYSDEFNLKETLVDLYKKMQ 159
gi 218901701  84 LTEVVTTTKNFSYHEGLVIEAWKMRHAQDVAGNLYNRLQQDRDISVISASIDELSAIEETGYSDEFNLKETLVDLYKKMQ 163
gi 218902142  81 LMDGVPTTRNFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKNEEIIGETITALCELEEQDCVCEFDLKDALVDLYEELH 160
gi 225862892  81 LMDGVPTTANFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKNEKIIGETITALCELEEKDCVCEFDLKDALVDLYEELH 160
gi 163938835  81 LIEGVPTTANFSYYEGLVRGAWKMYQAGVLGHKMGERLIAEKDEKIIGETVTELCELEEKDCVCEFDLKDALVGLYEELH 160
gi 163941526  84 LTEVVTTTKNFSYHEGLVIEAWKMRHAQEVAGNLYNRLQHERDMSAISTSIDELSAIEETGYSDEFNLKETLVDLYKNMQ 163
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261063  161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
gi 30019111  164 QDVKEITGIESGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 243
gi 218895995 161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGSAVGLFSLEMSSKQLLKRMASCVSEV 240
gi 218898940 160 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIVGARPSMGKTAFVLNVAFHAASAHTATGIFSLEMGEEQLLKRMISSTGNI 239
gi 217958097 160 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIVGARPSMGKTAFVLNVAFHAASAQTATGFFSLEMGEEQLLKRMISSTGNI 239
gi 218901701 164 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIVGARPSMGKTAFVLNVAFHAASAQTATGFFSLEMGEEQLLKRMISSTGNI 243
gi 218902142 161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
gi 225862892 161 QDAKEITGIETGYTSLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
gi 163938835 161 QDTKENTGIETGYISLNKMTCGLQEGDFVVLGARPSMGKTAFALNVGLHAAKSGAAVGLFSLEMSSKQLLKRMASCVGEV 240
gi 163941526 164 IDVGDLTGIPTGYDDLNRMTAGLQEGDLIIIGARPSMGKTAFVLNIAFHAASAHTATGVFSLEMGEEQLLKRMISSTGNI 243
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261063  241 SGGRLKNPKHRFAIEDWERVSKAFAEIGELPLEIYDHAGVTVQDIWMQTRKLKRKHGDKKILIIVDYLQLITGDPKHKGN 320
gi 30019111  244 SGGRLKNPKHRFAMEDWEKVSKAFAEIGELPLEIYDNAGVTVQDIWMQTRKLKRKHGDNKILIIVDYLQLITGDPKHKGN 323
gi 218895995 241 SGGRLKNPKHRFAIEDWEKVSKAFAEIGKLPLEIYDNAGISVQDIWMQTRKLKRKHGDKKVLVIVDYLQLITGDPKHKGN 320
gi 218898940 240 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKARKLKRKYPDKKVLIAIDYLQLIVGDLKHRGN 319
gi 217958097 240 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKTRKLKRKYPEKKVLVAIDYLQLIVGDPKHKGN 319
gi 218901701 244 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKTRKLKRKYPEKKVLVAIDYLQLIVGDPKHKGN 323
gi 218902142 241 SGGRLKNPKHRFAMEDWEKVSKAFAEIGELPLEIYDNAGVTVQDIWMQTRKLKRKHGDKKILMIVDYLQLITGDPKHKGN 320
gi 225862892 241 SGGRLKNPKHRFAIEDWEKVSKAFAEIGELPLEIYDNAGISVQDIWMQTRKLKRKHEDKKILVIVDYLQLITGDPKHKGN 320
gi 163938835 241 SGGRLKNPKHRFAMEDWEKVSKAFAEIGELPLEIYDNAGVMVQDIWMQTRKLKRKHGDKKLLVIVDYLQLITGDPKHKGN 320
gi 163941526 244 DATKLKNPKKLCNLKDWEKISQAMGLINDLPLEIYDKANVTMQEIYAKTRKLKRKYPDKKVLVAIDYLQLIVGDSKHRGN 323
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 30261063  321 RFQEISEISRKLKLLARELNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETMQKEMTEI 400
gi 30019111  324 RFQEISEISRKLKLLARELNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETMQKEMTEI 403
gi 218895995 321 RFQEISEISRKLKLLARELNVCVVALSQLSRSVEARQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETVQKEMTEI 400
gi 218898940 320 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 399
gi 217958097 320 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 399
gi 218901701 324 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 403
gi 218902142 321 RFQEISEISRKLKLLARELNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETKQKEMTEI 400
gi 225862892 321 RFQEISEISRKLKVLARELNVCVVALSQLSRSVEARQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETVQKEMTEI 400
gi 163938835 321 RFQEISEISRKLKLLARDLNVCVVALSQLSRSVESRQDKRPLLSDLRETGQIEQDADVIMLMYREDYYDKETMQKEMTEI 400
gi 163941526 324 RMQEIGEISRKLKLMARELNVCVVALSQLSRAVESRQDKRPLLSDLRENGQIEQDADLIAFLYREDYYDRETENKNITEI 403
                        410       420
                 ....*....|....*....|....*...
gi 30261063  401 HVAKHRNGPVGSFKLRFMKEFGRFVEGG 428
gi 30019111  404 HVAKHRNGPVGSFKLRFLKEFGRFVEIG 431
gi 218895995 401 HVAKHRNGPVGSFKLRFLKEFGQFVEGV 428
gi 218898940 400 ILAKQRNGPVGVVELAFIKEFSKFVNLE 427
gi 217958097 400 ILAKQRNGPVGVVELAFIKEFSKFVGLE 427
gi 218901701 404 ILAKQRNGPVGVVELAFIKEFSKFVGLE 431
gi 218902142 401 HVAKHRNGPVGSFKLRFMKEFGRFVEGK 428
gi 225862892 401 HVAKHRNGPVGSFKLRFLKEFGRFVEVG 428
gi 163938835 401 HVAKHRNGPVGSFKLRFLKEFGRFVEMV 428
gi 163941526 404 ILAKQRNGPVGVVELAFIKEFSKFVNLE 431
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap