Conserved Protein Domain Family
PRK06072

?
PRK06072: PRK06072 
enoyl-CoA hydratase; Provisional
Statistics
?
PSSM-Id: 168377
View PSSM: PRK06072
Aligned: 12 rows
Threshold Bit Score: 386.056
Threshold Setting Gi: 16081562
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
229583462   1 MIKVESREGYAIVTMSRADKLNALNLQMRNEFISKLKQINADPKIRTVIVTGEGRAFCVGADVNEFAPDFA-----IDLR 75 
284999203   1 MIKVESREGYAIVTMSRADKLNALNLQMRNEFISKLKQINADPKIRTVIVTGEGRAFCVGADVNEFAPDFA-----IDLR 75 
238621108   1 MIKVESREGYAIVTMSRADKLNALNLQMRNEFISKLKQINADPKIRTVIVTGEGRAFCVGADVNEFAPDFA-----IDLR 75 
227828916   1 MIKVESREGYAIVTMSRADKLNALNLQMRNEFISKLKQINADPKIRTVIVTGEGRAFCVGADVNEFAPDFA-----IDLR 75 
229586123   1 MIKVESREGYAIVTMSRADKLNALNLQMRNEFISKLKQINADPKIRTVIVTGEGRAFCVGADVNEFAPDFA-----IDLR 75 
227831651   1 MIKVESREGYAIVTMSRADKLNALNLQMRNEFISKLKQINADPKIRTVIVTGEGRAFCVGADVNEFAPDFA-----IDLR 75 
229580606   1 MIKVESREGYAIVTMSRADKLNALNLQMRNEFISKLKQINADPKIRTVIVTGEGRAFCVGADVNEFAPDFA-----IDLR 75 
70607994    1 -MIVENKDGYAIVKFDRPEKLNALNLKTRNDMISILRKLNADPTVKSVILTGEGRGFCVGADLSEMVEDIY-----ADLK 74 
15899348    1 MIKVDNKDGYVVVTISRADKLNALNLEMRNELISKLKEINANPKIRTVILTGEGRAFCVGADVNEFAPDFT-----IDLR 75 
15922749    4 EILVEDRGSISVITLNRPDKLNAMNLDLRNQLIKALRDFNRDPKKRVAVITGSGRSFSVGADISSISEDLA-----EDLR 78 
16081562    1 --------MVATITIDRPNRMNALDSETRRVIISALDEIENNADIRVVIITGSGKVFSAGADLSDTRGEISedllrSDLE 72 
146303170   3 LVQIRDHGPVSVISLSRPDKLNALSLELRSELLGSLKRFNSDPGKRVAILTGEGKAFSVGADLGSISSDLT-----EDLR 77 
229583462  76 ETFYPIIREIRFSDKIYIAAINGITAGACIGISLSTDFKFAKRDVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
284999203  76 ETFYPIIREIRFSDKIYIAAINGITAGACIGISLSTDFKFAKRDVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
238621108  76 ETFYPIIREIRFSDKIYIAAINGVTAGACIGISLSTDFKFAKRDVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
227828916  76 ETFYPIIREIRFSDKIYIAAINGVTAGACIGISLSTDFKFAKRDVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
229586123  76 ETFYPIIREIRFSDKIYIAAINGVTAGACIGISLSTDFKFAKRDVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
227831651  76 ETFYPIIREIRFSDKIYIAAINGITAGACIGISLSTDFKFAKRDVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
229580606  76 ETFYPIIREIRFSDKIYIAAINGITAGACIGISLSTDFKFAKRDVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
70607994   75 YTFQPIIKEIRNPNKLYISAINGVVAGACLGIVLSTDFRISRKDVKFVTAFQRIGLTSDTGVAYFLAKLV-GVKSYDLLI 153
15899348   76 ETFYPIIREIRFSDKIYIAAINGVTAGACIGISLSTDFKFAKREVKFVTAFQRLGLASDTGVAYFLLKLTrDQRAYEIAV 155
15922749   79 NSFHQVIKEIKFSNKIFISAVRGVVAGAGLSLALATDIRFASKDSRFVMAFHNIGLAPDSGLALMMLRLG-GVKFEKYIL 157
16081562   73 DSFHIIAKKIRNSRKIFISAVDGIAAGAGISIAFLCDLVFASPRTRFVLAFQGVGLAPDTGLSYILTKLA-GARFSRHLI 151
146303170  78 SSFYPILREIRFSSKIYISAVNGVTAGAGISLALACDVRIASRGSRFVTAFHNIGLAPDTGLTLILARLG-GTRFLDRLL 156
229583462 156 LGGEFTAEEAERWGLLKVSENPLHDAEEMANRINNGPFQSYIAAKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
284999203 156 LGGEFTAEEAERWGLLKVSENPLHDAEEMANRINNGPFQSYIAAKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
238621108 156 LGGEFTAEEAERWGLLKVSENPLHDAEEMANRINNGPFQSYIAAKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
227828916 156 LGGEFTAEEAERWGLLKVSENPLHDAEEMANRINNGPFQSYIAAKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
229586123 156 LGGEFTAEEAERWGLLKVSENPLHDAEEMANRINNGPFQSYIAAKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
227831651 156 LGGEFTAEEAERWGLLKVSENPLHDAEEMANRINNGPFQSYIAAKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
229580606 156 LGGEFTAEEAERWGLLKVSENPLHDAEEMANRINNGPFQSYIAAKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
70607994  154 LGGEFTAEDAEKWGLVKISEDPLSDAVKLAQRISAGPFLTYVAGKKMVNKILFEDMDDFLEYEALLQSELGKTEDFKEGV 233
15899348  156 LGGEFTAEDAERWGLLKISENPLYDAEEMANKILNGPFQSYIAGKRMANLVLYNDLERFLEYESAIQGYLGKTEDFKEGI 235
15922749  158 TGGEFNTEIARELGF-EIVDDPLSEALKRAEEISNGPFKSFSASKRLINRVLYQDLEEFLDYEAAMQGALGKTHDFKEGI 236
16081562  152 VGGEFSAEYAHEAGILELASDPLSQARDMARSIASGPFKAYSTAKAFITYSLFGDFEEFLRLESRDQSKLALSHDFVEGV 231
146303170 157 LGGEITAEELEREGILKISDDPLSEALKLGEEISSGPFRSYVASKKLINRALYHDLEEYLEYESAMQGYLGTTQDFKEGV 236
229583462 236 SSFKEKREPKFKGI 249
284999203 236 SSFKEKREPKFKGI 249
238621108 236 SSFKEKREPKFKGI 249
227828916 236 SSFKEKREPKFKGI 249
229586123 236 SSFKEKREPKFKGI 249
227831651 236 SSFKEKREPKFKGI 249
229580606 236 SSFKEKREPKFKGI 249
70607994  234 QSFIEKREPKYKGR 247
15899348  236 SSFKEKREPKFKGV 249
15922749  237 KAFLEKRKPQFKGE 250
16081562  232 AAFREKRKPRFTGN 245
146303170 237 KAFLEKRKPSFRGE 250
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap