Conserved Protein Domain Family
PLN02979

?
PLN02979: PLN02979 
glycolate oxidase
Statistics
?
PSSM-Id: 166620
View PSSM: PLN02979
Aligned: 2 rows
Threshold Bit Score: 676.44
Threshold Setting Gi: 145332395
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
145332397   1 MDSSREQKRFCKDPVSFsflfvrqeILFVIGFYNRCDAYLGLFNSFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAMQ 80 
145332395   3 QSQSRSCLRWCTTTMHL--------VQKTNGLFKRTETLLQGSCDFRPRILIDVSKIDMTTTVLGFKISMPIMVAPTAMQ 74 
145332397  81 KMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRL 160
145332395  75 KMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRL 154
145332397 161 GRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARIA 240
145332395 155 GRRESDIKNRFTLPPNLTLKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDARIA 234
145332397 241 IQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGEA 320
145332395 235 IQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALALGASGIFIGRPVVFSLAAEGEA 314
145332397 321 GVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDTPRPSARL 366
145332395 315 GVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWDTPRPSARL 360
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap