Conserved Protein Domain Family
7TM_GPCR_Srt

?
pfam10321: 7TM_GPCR_Srt 
Serpentine type 7TM GPCR chemoreceptor Srt
Chemoreception is mediated in Caenorhabditis elegans by members of the seven-transmembrane G-protein-coupled receptor class (7TM GPCRs) of proteins which are of the serpentine type. Srt is a member of the Srg superfamily of chemoreceptors. Chemoperception is one of the central senses of soil nematodes like C. elegans which are otherwise 'blind' and 'deaf'.
Statistics
?
PSSM-Id: 402096
View PSSM: pfam10321
Aligned: 37 rows
Threshold Bit Score: 338.037
Threshold Setting Gi: 75028319
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O17701     3 RFIEFGSATSIPLYNCShipltPEqWSEKdGVSRPIFGATEFTFGMLIEILYIPLIVVMLEKKNFsMSCYKIMVFLALID 82  Caenorhabditis elegans
Q9N526     3 SLLIYGSVQANPLYNCSak--pASqWTDElGTQRIFLGVILIIFGIIVEILYVPCLGAIYKKKLLqHSCYKIMFLLGITD 80  Caenorhabditis elegans
Q19556     3 RIIQYGSVEGIPYYNCSak--tSEeWFAT-GVQRPLFGWSILIFGIVIELLYIPTIYMMFRTKLIhLTCYKIIVCLGVTD 79  Caenorhabditis elegans
Q9NAI0     3 RLIRYGNIDSIPYYNCSwr--tSEeWDLQ-GLKRPILGWFLVLFGGFVEILYLPILYIIFKTKLIrYACYKLIVFLTLTD 79  Caenorhabditis elegans
Q9U2H5     5 RLLYYGSVEAIPFYNCSw----KSeWFET-GVKRPFLGYSIMIFGVFIEFLYPPIIYLIFKTKLIrHSCYKIIVFLSIID 79  Caenorhabditis elegans
CAP32569   3 RLIHYGSTDAIPFYNCSwk--pESeWWQN-GVQRPWLGYPITTFGIFIELLYIPIVWIIFKTKLIrHTCYKIIVLLAATD 79  Caenorhabditis brig...
Q9XUC8     3 RLLEYGSVEAIPYYNCShk--nFTeWEKT-GQKRPYFGWPLVVFGVLVELLYIPVIYIIFKTKLIrHPCYKIIVLLALID 79  Caenorhabditis elegans
Q9U2H7     3 RLIEYGSVEAIPYYNCSrm--sFPeWEKT-GVKRPWLGYPLIIFGIFIELLYLPIVYIIFKTNLIkHVCYKIIVVLAFVD 79  Caenorhabditis elegans
Q22983     3 HILRYGSIDRIPMYNCSar--tPSqWTLEtGEPQPIIGPLQVAYGIIVLTLYIPIALIMLEKENYkLTSFKIMFQLAITD 80  Caenorhabditis elegans
Q22982     3 NIFKYGSIENIPMYNCSar--tPAqWSYEsGESHPIIGSLQIVYGVIVNLLYLPISKIMLEKENYkLSSFKIMFHLAVTD 80  Caenorhabditis elegans
O17701    83 FVAVIFSCLMTGFLTFQGAVFCTYPNLIYISGCTAKCTWTGSCLTAMILVINRLLDLSFNRIKNILFDGNRTFLILIIPF 162 Caenorhabditis elegans
Q9N526    81 MLTTCTATILSGYLLTVGAVFCTYPELIYVAGCFALGGWVSSCAWTLLLVINRISDMIAPRISDFLFSGNRTWIVALIPI 160 Caenorhabditis elegans
Q19556    80 MLATLTCSIFSGWLFIKGAVYCNYPTFIYLAGCLGLSGWCMACGSTLLLVINRVFDVLCRPVSEFLFDGKRVFFSIALIY 159 Caenorhabditis elegans
Q9NAI0    80 MSATVCSSIISGVLYIKGSVFCSYPTFEYIAGGFAINTWCMACAINISLFANRVCSIAFHEYIDVI-EGKLTYFCITISA 158 Caenorhabditis elegans
Q9U2H5    80 MIATVCSCFISGSLFIQGAVFCSYPSFIYITGTIVLTTWCTSCACTLFLFINRIVNITLPQYSDLI-EAKLAYFSIILSI 158 Caenorhabditis elegans
CAP32569  80 MCAISCSCIITGILLIQGAVFCAYPTFIYICGGIALCTWCGACAITLSLFLNRIVSIGFRDYADVI-EKPMGYISMVLSV 158 Caenorhabditis brig...
Q9XUC8    80 ITATCCSCLITGPMLIMGTVFCMYPTFTYVAGGIAISTWCMACAATTSLFSNRIISIGFRKYADVI-EKKLAYTSISFVL 158 Caenorhabditis elegans
Q9U2H7    80 MMATACSCFITGTLLVIGSVFCMYPTFTYVTGGFVLAMWCMACATTVSLFLNRVISLAFHEYADSI-EKRLAYISILFCF 158 Caenorhabditis elegans
Q22983    81 IIGISINSVLTGILAIQGAVFCTYPTFIYLSGLFVMCLWCLTCLTSLILVCNRLLIFFNPNIEAQLFEGRKTFIILGFSL 160 Caenorhabditis elegans
Q22982    81 VLVIFINSILTGILAIQGAVYCTYPNLIYITGSIAMCLWCSSCFTSLILVINRLLILWKPSVEMQMFEGNKTPALLCCSV 160 Caenorhabditis elegans
O17701   163 GYASYFLIFNPPIVFTSKFHSWFFDPLIfeGRSAE------YNNIPVLFNNFLIVITTCCLYMFFCCALGAKTKNTkTSS 236 Caenorhabditis elegans
Q9N526   161 PYTLSVMFFTPAIIFNSTVMAWIGDPLIyeERAQD------YYNPIQNLNNVVFISGTIVLYGAYCFFMAKK-----TMG 229 Caenorhabditis elegans
Q19556   160 TYGTLVSMFSPSIIFNSAIMAWIADPLTidPEYKTdeitdwYRNHVQSTNNWIFCSGTCTLYAIYCVLINKM-----QRG 234 Caenorhabditis elegans
Q9NAI0   159 IYGTFILFYTPIICFNSKALAWIPEPLSeiDDSKEse--kyYNNDWQSWNNYLFVAIMFFLYITYCVLIKKL-----AHG 231 Caenorhabditis elegans
Q9U2H5   159 IYGFYYVFFTPTLCFNSGGMAWFPDPFSekEPSKEaa--eyYKNRSQGWHNWIFVTAMVLLYVIYFLKVRKI-----ARG 231 Caenorhabditis elegans
CAP32569 159 VYMFYISFFTTPACFNSLIMAWPSDPLSekEPSKEas--ifYRNDSQAWNNWIFITCMLFMFTIYCGLVNKL-----ARG 231 Caenorhabditis brig...
Q9XUC8   159 FYGFYICWFTPTTAYNSVFMAWIPDPLSeeVPSKEaa--amYKHTILPWNNWIFVACMFILFSVYFIMVKRM-----AKG 231 Caenorhabditis elegans
Q9U2H7   159 SYAFYIFMFTPSIVYNSVFLAWIPDPLSelKPSKEaa--amYKNVPQAWNNWIFVSCMFILFSIYCAMVKKI-----ARG 231 Caenorhabditis elegans
Q22983   161 VYGGYFL-FTTPHVYNSKHLAWFFDPMIfpGRAHD------YDNFSHAFNNFSIVAITCVLYIPFYEIVRKRLKDAhSHS 233 Caenorhabditis elegans
Q22982   161 IYGSYFL-FTTPHVYNSKHLAWFYDPMIfpGRAKE------YDNIYHGVNNFSIVAITCALYIPFYKIVRGNLKISgSNS 233 Caenorhabditis elegans
O17701   237 QTRKMSLQIFFQSAMICAVNFSASMIYVIMNYVEVPFSIILFGQFTWQMGSASPVFIYLTLNKTIRNGVLLKLGlTFAFG 316 Caenorhabditis elegans
Q9N526   230 YKVSAGKNVFIQSTLICSINCSSALVYSSMMFHKPNEYIVLFGELAWSFVHGCPAIIYLTMNKTVRQEVLRWIR-RKNPA 308 Caenorhabditis elegans
Q19556   235 QKSKASRQVFIQSSIICSFNTFSAMSYNALMFTVPAPWVIAIAELCWSIVHGCPAIIYLTMNKTIRTEFLKFLK----LK 310 Caenorhabditis elegans
Q9NAI0   232 QKSKKSRAIFIQCCIICFFNTATALIYNALSLMTPALWILYLGQLSWSLNHGCPAIIYLTMNDTIRKNFFRTFCrFKNTK 311 Caenorhabditis elegans
Q9U2H5   232 QKSKASTAILVQCIIICFFNTTCALIYNSFTLITPDPWVLLLGQYCWCVNHGCPALIYITINDTIRKGFRKLLF--NGTR 309 Caenorhabditis elegans
CAP32569 232 QNSKASRAIFIQCCIICFFNSCTAIFYNVLAFITPSPAILVFGQLCWSINHGCPALIYVTLNDTIRREFKKLIFrSSTNK 311 Caenorhabditis brig...
Q9XUC8   232 QKSKASRSIFIQCSIICFFNTGTALVYNALAIVTPAEWILAFGQICWTCNHASPAIIYVSLNSTIRREFLKIVF-----R 306 Caenorhabditis elegans
Q9U2H7   232 QKSKASMAIFFQCAIICFFNTVSAMVYNAVAFITPDFWILLLGQLCWSINHGCPALIYITMNETIKREFKKLVFgIKSKK 311 Caenorhabditis elegans
Q22983   234 RAQNMKLQVFIQSVLICIATQIASIIYVFMNLFKVSTCVILIGHALWQFVQGAPVFIYIGLNEQIRKRFFQLLR-CHGNG 312 Caenorhabditis elegans
Q22982   234 RFHNAKLQIYLQSVLICVASQAAAIIYVVMNFVQVPPIVVVSGHLLWELVHGAPVFIYISFNDMIRKRFLEIFG-CKNVV 312 Caenorhabditis elegans
O17701   317 KTS 319 Caenorhabditis elegans
Q9N526   309 VQD 311 Caenorhabditis elegans
Q19556   311 KTN 313 Caenorhabditis elegans
Q9NAI0   312 IDT 314 Caenorhabditis elegans
Q9U2H5   310 VED 312 Caenorhabditis elegans
CAP32569 312 IEE 314 Caenorhabditis briggsae
Q9XUC8   307 NTL 309 Caenorhabditis elegans
Q9U2H7   312 IET 314 Caenorhabditis elegans
Q22983   313 VGS 315 Caenorhabditis elegans
Q22982   313 TPQ 315 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap