1DJG


Conserved Protein Domain Family
EF-hand_like

?
pfam09279: EF-hand_like 
Phosphoinositide-specific phospholipase C, efhand-like
Members of this family are predominantly found in phosphoinositide-specific phospholipase C. They adopt a structure consisting of a core of four alpha helices, in an EF like fold, and are required for functioning of the enzyme.
Statistics
?
PSSM-Id: 401279
View PSSM: pfam09279
Aligned: 23 rows
Threshold Bit Score: 135.452
Threshold Setting Gi: 556972012
Created: 21-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DJG_A        72 FYKMLTQRAEIDRAFEEAAGSAETLSVERLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSAD 151
Q8K3R3       198 FYKALTKRTEIEEIFEDFSSDKQKLTLLEFVDFLRKEQKEKDHAPDLALELIDRYEPSENGRLLHVLSKDGFLKYLCSKD 277 house mouse
EHB02446     222 FYKALTKRNEVQELFENFSADGQKLTLLEFVDFLQEEQKEKDYAPDLALELINCHEPSDSGKLRHVLSMDGFLSYLCSKD 301 naked mole-rat
XP_008110417 226 FYKILMERKEIDRIFSEQSKGKKTMSLDDLVGFLRTQQHEKNASPKLALSLIEKYEPNKAVKGQRSMTKDGFQMYLLSAD 305 green anole
XP_028934190 204 FYKMLTKRPEIDEIFQSIAGSADTLSVDRLVQFLRLEQKED-ADPKMAHSLIERYEPSETAKEAKEMTKDGFLMYLLSAD 282 platypus
P10895       204 FYKILTQRKEIDRTFEEATGSKETLSVDQLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSAD 283 cattle
XP_023354306 204 FYRKLTQREEIDRLFEDISGSQETLSVDQLVTFLQQEQKEEEASPQLALALIQRYEPSEAAKEQKQMTKDGFLIYLLSAD 283 Tasmanian devil
XP_004079075 202 LYDLLSQRVEIDVIYQEYAKTTGFMSAHNLVEFLMKEQRER-ASLADAHSIIDKYEPDEQVKQKKLLSKDGFLMYMQCPE 280 Japanese medaka
XP_003457468 224 FYDLLTQRDEIDVIYGEYAKTTGFMSAQNLVDFLMKEQREK-ATLADAHRIIEMYEPDENAKEKKLLSKDGFLMYLNHPD 302 Nile tilapia
POI29774      45 FYKILTERKEIDTIFQKYSDAEGLMSCQNLVRFLYETQQEEDAVVA-APPLIQRYEPSERAKKRNAMTKDGFLMYLLSDD 123 Chinese bamboo-...
1DJG_A       152 GNAFS 156
Q8K3R3       278 GNIFN 282 house mouse
EHB02446     302 GDIFN 306 naked mole-rat
XP_008110417 306 GNIFN 310 green anole
XP_028934190 283 GNVFN 287 platypus
P10895       284 GSAFD 288 cattle
XP_023354306 284 GSAFS 288 Tasmanian devil
XP_004079075 281 IMILN 285 Japanese medaka
XP_003457468 303 AMILN 307 Nile tilapia
POI29774     124 GNIFN 128 Chinese bamboo-partridge
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap