1DJG


Conserved Protein Domain Family
EF-hand_like

?
pfam09279: EF-hand_like 
Click on image for an interactive view with Cn3D
Phosphoinositide-specific phospholipase C, efhand-like
Members of this family are predominantly found in phosphoinositide-specific phospholipase C. They adopt a structure consisting of a core of four alpha helices, in an EF like fold, and are required for functioning of the enzyme.
Statistics
?
PSSM-Id: 370403
View PSSM: pfam09279
Aligned: 27 rows
Threshold Bit Score: 135.067
Threshold Setting Gi: 556972012
Created: 3-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1DJG_A         72 FYKMLTQRAEIDRAFEEAAGSAETLSVERLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSAD 151  Norway rat
XP_008110417  226 FYKILMERKEIDRIFSEQSKGKKTMSLDDLVGFLRTQQHEKNASPKLALSLIEKYEPNKAVKGQRSMTKDGFQMYLLSAD 305  green anole
XP_004079075  202 LYDLLSQRVEIDVIYQEYAKTTGFMSAHNLVEFLMKEQRER-ASLADAHSIIDKYEPDEQVKQKKLLSKDGFLMYMQCPE 280  Japanese medaka
XP_007657073   45 FYKMLTKRPEIDEIFQSIAGSADTLSVDRLVQFLRLEQKE-DADPKMAHSLIERYEPSETAKEAKEMTKDGFLMYLLSAD 123  platypus
XP_023354306  204 FYRKLTQREEIDRLFEDISGSQETLSVDQLVTFLQQEQKEEEASPQLALALIQRYEPSEAAKEQKQMTKDGFLIYLLSAD 283  Tasmanian devil
POI29774       45 FYKILTERKEIDTIFQKYSDAEGLMSCQNLVRFLYETQQEEDAVVA-APPLIQRYEPSERAKKRNAMTKDGFLMYLLSDD 123  Chinese bambo...
OCA19831      209 FYKILTEREEIDVIFATYADGGNFMSSDNLIRFLQQEQRES-AGAEYAKSLIDKYEPSEQAKKQEAMTKDGFLIYLLSDD 287  tropical claw...
XP_022534883  201 FYEILTQREEIDVIYGEYAKTDGLLSATNLLEFLVKEQREQ-VDLAYAVQLIEKYEVDKTAKAKQMMTKDGFLMYLRQPK 279  Mexican tetra
XP_003457468  224 FYDLLTQRDEIDVIYGEYAKTTGFMSAQNLVDFLMKEQREK-ATLADAHRIIEMYEPDENAKEKKLLSKDGFLMYLNHPD 302  Nile tilapia
ELR44708       54 FYKILTQRKEIDRTFEEATGSKETLSVDQLVTFLQHQQREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSAD 133  wild yak
1DJG_A        152 GNAFS 156  Norway rat
XP_008110417  306 GNIFN 310  green anole
XP_004079075  281 IMILN 285  Japanese medaka
XP_007657073  124 GNVFN 128  platypus
XP_023354306  284 GSAFS 288  Tasmanian devil
POI29774      124 GNIFN 128  Chinese bamboo-partridge
OCA19831      288 GNLFN 292  tropical clawed frog
XP_022534883  280 GLIMN 284  Mexican tetra
XP_003457468  303 AMILN 307  Nile tilapia
ELR44708      134 GSAFD 138  wild yak
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap