6C6P


Conserved Protein Domain Family
SE

?
pfam08491: SE 
Click on image for an interactive view with Cn3D
Squalene epoxidase
This domain is found in squalene epoxidase (SE) and related proteins which are found in taxonomically diverse groups of eukaryotes and also in bacteria. SE was first cloned from Saccharomyces cerevisiae where it was named ERG1. It contains a putative FAD binding site and is a key enzyme in the sterol biosynthetic pathway. Putative transmembrane regions are found to the protein's C-terminus.
Statistics
?
PSSM-Id: 400679
View PSSM: pfam08491
Aligned: 12 rows
Threshold Bit Score: 444.466
Threshold Setting Gi: 1559969985
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6C6P_B       161 HAPLTVVADGLFSKFRKSLV-SNKVSVSSHFVGFLMKNAPQFKANHAELILAN-PSPVLIYQISSSETRVLVDIRGE-MP 237 human
Q9C1W3       159 KAPLTIVCDGCFSKFRKAFI-DHPIQVTDHFLGLILTNPDYIAPGRGHVILSK-VAPMVLYPISSTEARILINYPGKnLP 236 Schizosaccharom...
Q6C5R8       192 FAPLTVVCDGTFSKFRKDFS-TNKTSVRSHFAGLILKDAVLPSPQHGHVILSPnSCPVLVYQVGARETRILCDIQGP-VP 269 Yarrowia lipoly...
Q6BI11       194 TAKLTISCDGIYSKFRKELSaENVPIIGSYFVGLKLIDAKLPMVNRGHVILGS-HAPILIYQISPHETRILCAYRSTkPP 272 Debaryomyces ha...
Q75F69       202 KAHMTFVCDGIFSRFRKELStTNTSKVWSSFVGLSLHHADLPTKHHGHVILGSeHMPVIAYQISSTETRILCAYNYPtLP 281 Eremothecium go...
Q6CJX6       205 KAHLTFVCDGIFSRFRKELSpDHIPSVGSSFVGMSLFHANIPSKNHGHVILGTsHMPVLVYQISSEETRILCAYNSArLP 284 Kluyveromyces l...
O13306       194 KAHLTFVCDGIFSRFRRELHpDHVPTVNSSFVGMSLYHAHMPHDMHGHVILGDkHMPILVYQISPEETRILCAYNAPkVP 273 [Candida] glabr...
Q92206       192 HAKLTISCDGIYSKFRKELSpTNVPTIGSYFIGLYLKNAELPAKGKGHVLLGG-HAPALIYSVSPTETRVLCVYVSSkPP 270 Candida albican...
XP_013643445 200 FAPLTVVCDGCHSNLRRSLN-DNNAEVTAYEIGYISRNCRLEQPDKLHLIMAK-PSFAMLYQVSSTDVRCNFELLSKnLP 277 rape
XP_009141944 199 FAPLTVVCDGCYSNLRRSVN-DNNAEVISYQVGYVSKNCQLEDPEKLKLIMSK-PSFTMLYQISSTDVRCVMEIFPGnIP 276 field mustard
O81000       273 FAPLTIVCDGCFSNLRRSLC-KPKVDVPSTFVGLVLENCELPFANHGHVVLGD-PSPILMYPISSSEVRCLVDVPGQkLP 350 thale cress
Q9SM02       211 FAALTIVCDGCFSNLRRSLC-NPQVEVPSCFVGLVLENCNLPYANHGHVVLAD-PSPILMYPISSTEVRCLVDVPGQkVP 288 thale cress
6C6P_B       238 R----NLREYMVEKIYPQIPDHLKEPFLEATDNS-HLRSMPASFLPPSSVKK---RGVLLLGDAYNMRHPLTGGGMTVAF 309 human
Q9C1W3       237 Pm--eTLKKYVLESCVPNMPEKLRPSLKAAVYND-RLRSMPNQFLPPTVNRT---KGMILVGDSNNMRHPLTGGGMTVCF 310 Schizosaccharom...
Q6C5R8       270 SnatgALKEHMEKNVMPHLPKSIQPSFQAALKEQ-TIRVMPNSFLSASKNDH---HGLILLGDALNMRHPLTGGGMTVAL 345 Yarrowia lipoly...
Q6BI11       273 SqtsdELYNYLRDEVLPALPKETQPSFEKALETR-KFRAMPNQYLPAVKQGKe-tKGLVMLGDSLNMRHPLTGGGMTVGL 350 Debaryomyces ha...
Q75F69       282 K----NVPEWLQKEVQPFIPPSLRKSFDAALESK-SYKCMPNSWLPASQNNV---TGLCVVGDALNMRHPLTGGGMAVGL 353 Eremothecium go...
Q6CJX6       285 K----DIKSWLTTDVKPYLPKSLLPSFDKAVEDG-KFRSMPNSYLPAKQNTV---TGLCVIGDALNMRHPLTGGGMAVGL 356 Kluyveromyces l...
O13306       274 T----DLKSWMTKDVQPYIPKTLRPSFDDALAQG-KFKPMANSWLPARQNDV---TGLCVIGDALNMRHPLTGGGMTVGL 345 [Candida] glabr...
Q92206       271 SaandAVYKYLRDNILPAIPKETVPAFKEALEER-KFRIMPNQYLSAMKQGSenhKGFILLGDSLNMRHPLTGGGMTVGL 349 Candida albican...
XP_013643445 278 SvsngEMASFVKNSIAPQVPLKLRKTFLKGLDEGsHIKITQAKRMPATLSRK---KGVIVLGDAFNMRHPVIASGMMVLL 354 rape
XP_009141944 277 SisngEMAVYLKNTMAPQVPPELRKIFLKGIDEGaQIKAMPTKRMEATLSEK---QGVIVLGDAFNMRHPAIASGMMVVL 353 field mustard
O81000       351 PiangEMAKYLKTRVAPQVPTKVREAFITAVEKG-NIRTMPNRSMPADPIPT---PGALLLGDAFNMRHPLTGGGMTVAL 426 thale cress
Q9SM02       289 SiangEMKNYLKTVVAPQMPHEVYDSFIAAVDKG-NIKSMPNRSMPASPYPT---PGALLMGDAFNMRHPLTGGGMTVAL 364 thale cress
6C6P_B       310 KDIKLWRKLLKGI--PDLYDDAAIFEAKKS-FYWARKTSHSfVVNILAQALYELFSATDDSLH-QLRKACFLYFKLGGEC 385 human
Q9C1W3       311 HDAYLLSRFISPSavPDLLDYERILNQMNK-FHWKRKGYSF-VINVLSIALYKLFTPKNRYMK-ALESGCIDYFKRGGNC 387 Schizosaccharom...
Q6C5R8       346 NDALLLSRLLTGV---NLEDTYAVSSVMSSqFHWQRKHLDS-IVNILSMALYSLFAADSDYLR-ILQLGCFNYFKLGGIC 420 Yarrowia lipoly...
Q6BI11       351 NDSVLLAKLLHPRyiEDFDNHELLGKQLST-FHRKRKNLDA-VLNTLSIALYTLFAADRNALL-ILQRGCFKYFLLGGDC 427 Debaryomyces ha...
Q75F69       354 MDVVLLVKTIGDM---DFSDREEVLNELLG-FHYERKAHAC-VINTLSIALYSLFAADSYYLK-KLQKGCFEYLGRGEDW 427 Eremothecium go...
Q6CJX6       357 NDVALLIKTVGDL---DFSDRETVLDELLE-YHFERKQYDS-VINVLSIALYSLFAADNRNLQ-VLQRGCFKYFERGGDC 430 Kluyveromyces l...
O13306       346 NDVVLLIKKIGDL---DFSDREKVLDELLD-YHFERKNYDA-VVNVLSISLYSLFAADSKNLK-ALQKGCFKYFQRGGDC 419 [Candida] glabr...
Q92206       350 NDSVLLAKLLHPKfvEDFDDHQLIAKRLKT-FHRKRKNLDA-VINTLSISLYSLFAADKKPLR-ILRNGCFKYFQRGGEC 426 Candida albican...
XP_013643445 355 SDILILSRLLKPL--GNLGDENKVSEVMKS-FYVLRKPMSA-TVNTLGDSFWQVLIASTDEAKeAMRQGCFDYLSSGGFR 430 rape
XP_009141944 354 SDILILRRLLQPL--RNLSDANKISEVIKS-FYVIRKPMSA-TVNTLGNAFSQVLIASTDEAKeAMRQGCFDYLSSGGFR 429 field mustard
O81000       427 ADIVVLRDLLRPI--RNLNDKEALSKYIES-FYTLRKPVAS-TINTLADALYKVFLASSDEARtEMREACFDYLSLGGVF 502 thale cress
Q9SM02       365 ADIVVLRNLLRPL--RDLSDGASLCKYLES-FYTLRKPVAA-TINTLANALYQVFCSSENEARnEMREACFDYLGLGGMC 440 thale cress
6C6P_B       386 VAGPVGLLSVLSPNPLVLIGHFFAVAIYAVYFCFKSEPWITKPRALL 432 human
Q9C1W3       388 VEGPIRLLGGLDHSPSHLIGHFYAVCLYGIYQYVLSGPALLMPVRII 434 Schizosaccharomyces pombe 972h-
Q6C5R8       421 VDHPVMLLAGVLPRPMYLFTHFFVVAIYGGICNMQANGIAKLPASLL 467 Yarrowia lipolytica
Q6BI11       428 VSGPIGLLSGILPFPMLLFNHFFSVAFYAIYCNFIDRGLIGFPLALL 474 Debaryomyces hansenii
Q75F69       428 VRQPISFLSGVLPSPYLLTKVFFTVALYSVLINFRGRTPLGFLLAIY 474 Eremothecium gossypii ATCC 10895
Q6CJX6       431 IRLPVSFLAGVLPKPFLLTKVFFSVALYSIYVNFQERGILGSPLALL 477 Kluyveromyces lactis
O13306       420 VNLPVAFLAGVLPKPLLLTRVFFAVAFYTIYLNMEERGFLGLPMALL 466 [Candida] glabrata CBS 138
Q92206       427 VNGPIGLLSGMLPFPMLLFNHFFSVAFYSVYLNFIERGLLGFPLALF 473 Candida albicans SC5314
XP_013643445 431 TSGLMALIGGMNPRPLSLFYHLFVISLSSIGQLLSPFP---TPLRVW 474 rape
XP_009141944 430 TSGMMALLGGMNPRPLSLIFHLCGITLSSIGQLLSPFP---SPLGIW 473 field mustard
O81000       503 SSGPVALLSGLNPRPLSLVLHFFAVAIYAVCRLMLPFP---SIESFW 546 thale cress
Q9SM02       441 TSGPVSLLSGLNPRPLTLVCHFFAVAVYGVIRLLIPFP---SPKRIW 484 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap