4IM7,3H2Z


Conserved Protein Domain Family
Mannitol_dh_C

?
pfam08125: Mannitol_dh_C 
Click on image for an interactive view with Cn3D
Mannitol dehydrogenase C-terminal domain
Statistics
?
PSSM-Id: 369700
View PSSM: pfam08125
Aligned: 14 rows
Threshold Bit Score: 251.146
Threshold Setting Gi: 240104510
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4IM7_A              233 DNVTFPSTMVDRIVPAVTEDTLAKIEQLTGVRDAAGVACEPFRQWVIEDNFVAGRPEWEKAGAELVSDVLPYEEMKLRML 312
P33029              216 EHVSFPGTMVDRIVPAATDESLVEISQHLGVNDPCAISCEPFIQWVVEDNFVAGRPAWEVAGVQMVNDVLPWEEMKLRML 295 Escheric...
P0CX09              229 DKVTSPNSMVDRVTPRCTDKERKYVADTWGIKDQCPVVAEPFIQWVLEDNFSDGRPPWELVGVQVVKDVDSYELMKLRLL 308 Saccharo...
rhodo:RCAP_rcc02027 209 aSVAFPNSMVDRITPATGDRER-AMAADLGLDDAAPVTCETFRQWVIEDKFPAGRPALEKVGVTFTPHVDKFETMKIRIL 287 Rhodobac...
Q3J1R3              208 AQVAFPNGMVDRITPATGPHER-ELAQGFGLADPVPVTCEPFRQWVIEDHFPAGRPALEKVGVTFTPHVHAYEAMKIRIL 286 Rhodobac...
wugsc:KPN_02543     195 aNTTCPNTMVDRITPRPAADLPARIKAQTGIDDKAPVMGETFIQWVVENNFRDARPNLEAVGVEMVESVIPYEEAKIRIL 274 Klebsiel...
O65992              148 KSVGFPNCTVDRIVPN----------VDIEKELPIDVAVEDFYEWDIEKNKVKI--NNKIIGAEYVEKLDPYLERKLFLL 215 Clostrid...
P09424              148 EHVGFVDSAVDRIVPPS----------ASATNDPLEVTVETFSEWIVDKTQFKG-ALPNIPGMELTDNLMAFVERKLFTL 216 Escheric...
P27543              148 QWIGFPDAAVDRIVP------------LQKHEDPLFVQVEPFCEWVIDDTNRKA-KEIQLEGVHYVADLEPYIERKLFSV 214 Enteroco...
Q02418              151 DYIGFPNAAVDRIVP------------AQVHEDPLFVVVEPFSEWVVETAAMKN-PDLKLSSVHYEENLEPFIERKLFSV 217 Streptoc...
4IM7_A              313 NGSHSFLAYLGYLAGYQHINDCMEDEHYRHAAYTLMLQEQAPTL-Kv--QGVDLQDYANRLIERYSNPALRHRTWQIAMD 389
P33029              296 NGSHSFLAYLGYLSGFAHISDCMQDRAFRHAARTLMLDEQAPTLqI---KDVDLTQYADKLIARFANPALKHKTWQIAMD 372 Escheric...
P0CX09              309 NGGHSAMGYLGYLAGYTYIHEVVNDPTINKYIRVLMREEVIPLLpKv--PGVDFEEYTASVLERFSNPAIQDTVARICLM 386 Saccharo...
rhodo:RCAP_rcc02027 288 NGGHAIIAYPGGLADIAFVHEAMADPQIRAFLNRVLTAEVLPIVpPv--PGQDLNDYKALIIERFSNPEVADTVRRLCLD 365 Rhodobac...
Q3J1R3              287 NGGHAVIAYPSALMDIQLVHEAMAHPLIAAFLHKVEVEEILPHVaPv--PDTSIPDYLTLIESRFSNPEIADTTRRLCLD 364 Rhodobac...
wugsc:KPN_02543     275 NASHSCIAWAGTLIGQQYIHESTLTDVIYAIADRYVTEDVIPCLgD---NGIDLPTYRDVVLKRFTNPYIQDTNQRVAAD 351 Klebsiel...
O65992              216 NGAHATIAYLGYLKGYKYIHEAIKDKEINKIIVGFHSEAVQALSeKhkiDIQILKEYSNKLLKRFENEYLKDDVSRVGRD 295 Clostrid...
P09424              217 NTGHAITAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIkRygfDADKHAAYIQKILGRFENPYLKDDVERVGRQ 296 Escheric...
P27543              215 NTGHATVAYTGALLGYQTIDEAMQDALVVAQLKSVLQETGKLLVaKwnfDEQEHAAYIEKIIQRFQNKYISDAITRVART 294 Enteroco...
Q02418              218 NSGHATTAYTGAYFGAKTVLEALKDQQVKEQVKAVLGEIRQLLMaKwqfKENDLKVYHDIIISRFENPYIVDDVTRVART 297 Streptoc...
4IM7_A              390 GSQKLPQRMLDSVRWHLAH-DSKFDLLALGVAGWMRYVGGVDEQGNPIEISDPLLPVIQK--AVQSSAEgtaRVQSLLAI 466
P33029              373 GSQKLPQRMLAGIRIHQGR-ETDWSLLALGVAGWMRYVSGVDDAGNAIDVRDPLSDKIRElvAGSSSEQ---RVTALLSL 448 Escheric...
P0CX09              387 GSGKMPKYVLPSIYEQLRKpDGKYKLLAVCVAGWFRYLTGVDMNGKPFEIEDPMAPTLKA--AAVKGGK---DPHELLNI 461 Saccharo...
rhodo:RCAP_rcc02027 366 GSNRQPKFIIPSIRDRIAT-GGSFDGLVLLSALWCRYCFGTTESGAEIAPNDPNWERLVA--VAQAAKD---RPAAWLEM 439 Rhodobac...
Q3J1R3              365 GSNRQPKFIVPSLRDNLAA-GTVPKGLVLLSALWCRYCYGTTDSGVVVEPNDPNWTALQD--RARRAKE---NPAEWLAM 438 Rhodobac...
wugsc:KPN_02543     352 GFSKIPAMIAPTLQECYQR-GVRPEATAMLPALFFVFMEQWHKGTLPYQYQDGILDAQAV--HEMFEAQ---DPVAVYAR 425 Klebsiel...
O65992              296 -----PMRKLSSNDRLIT---PLKLCCDLK-IDFTNILFGVASGYLFNYKEDEKAQGIQN----IITKE---GIKKAISN 359 Clostrid...
P09424              297 -----PLRKLSAGDRLIK---PLLGTLEYG-LPHKNLIEGIAAAMHFRSEDDPQAQELAA----LIADK---GPQAALAQ 360 Escheric...
P27543              295 -----PIRKLGAQERFIR---PIRELQERN-LVSPHLLAMIGIVFNYHDPEDEQSRQLQE----MLDQE---SVDTVIAE 358 Enteroco...
Q02418              298 -----PIRKLGYDERFIR---PIRELKDRG-LSYEYLLQTVAYVFHYKDSNDEQSVQLKL----LLQEK---SLKAVVKE 361 Streptoc...
4IM7_A              467 KAIFGDDLPGNSLF 480
P33029              449 REVFGDDLPDNPHF 462 Escherichia coli K-12
P0CX09              462 EVLFSPEIRDNKEF 475 Saccharomyces cerevisiae S288C
rhodo:RCAP_rcc02027 440 EDIYAEVGrnpavi 453 Rhodobacter capsulatus SB 1003
Q3J1R3              439 TEVYG-DLAQNDll 451 Rhodobacter sphaeroides 2.4.1
wugsc:KPN_02543     426 DKALFGDLANNADF 439 Klebsiella pneumoniae subsp. pneumoniae MGH 78578
O65992              360 VSQIKEGDYLNNMI 373 Clostridium acetobutylicum ATCC 824
P09424              361 ISGLDANSEVVSEA 374 Escherichia coli K-12
P27543              359 VTGIE-DPETVKNI 371 Enterococcus faecalis V583
Q02418              362 VTGLT-DAALIEEI 374 Streptococcus mutans UA159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap