2R85,2R7L


Conserved Protein Domain Family
DUF1297

?
pfam06973: DUF1297 
Click on image for an interactive view with Cn3D
Domain of unknown function (DUF1297)
This family represents the C-terminus (approximately 200 residues) of a number of archaeal proteins of unknown function. One member is annotated as being a possible carboligase enzyme.
Statistics
?
PSSM-Id: 399750
View PSSM: pfam06973
Aligned: 58 rows
Threshold Bit Score: 240.881
Threshold Setting Gi: 74514408
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2R85_B            150 DFWRKAEKFLG---IkRKEDLKNIQIQEYVLGVPVYPHYFYSKVR---EELELMSIDRRYESNVDAIGRIPAKDQLEFDM 223 Pyrococcus...
Q8U3N6            189 EFKEKSEKLIRlgvI-TREDLEKARIERYIIGPVFNFDFFYSPID---EEIELLGIDWRFETSLDGHVRLPAAQQLTLPE 264 Pyrococcus...
A0B858            188 EYYEKSELLLRqgvI-DSDGLELARIERYIIGPVFNLDFFYSPLR---DRIELLGIDWRFETSLDGHVRLPAPQQLRLNE 263 Methanothr...
AGN25689          191 EYVEKSEQLIKqgvI-DRETLQTARMEEYIIGPVFNLDFFYSPLEtlgEKVELIGVDWRFESSLDGHVRLPAPQQMTLNE 269 Candidatus...
AGI86112          191 qYVEKSQELIRqgvL-DEDFEKHARMEQYIIGPVFNLDFFYDPLEekgEKVELLGIDWRFESSLDGYVRLPAKQQVELEQ 269 Candidatus...
HusnBIG:Mpsy_0967 191 qYLEKSQALLKqgvI-TQEALEHARIERYIIGPVFNLDMFYSPLEsemSKTELLGVDWRFETSLDGHVRLPAPQQMSLAP 269 Methanolob...
WP_013897790      191 EYMEKAESLLKqgtI-TRDDLDNARIEEYIIGPVFNFDMFYSPIEenmSKLEILGVDWRFETSLDGHVRLPAPQQMNLSE 269 Methanosal...
jgi:Pyrfu_0911    180 DLERKLQELMEkgiI-DDKSLEEMVIEEFVDGAHFNVNFFYSVVR---GELELYSIDRRLQTNIDDINRWPAWVQERLEG 255 Pyrolobus ...
jgi:Igag_0271     182 DFQKRFNKLVAdgiI-KPEDMSRASIEELIIGAHFNVNYFNSIAR---KDVEIISIDRRLQTNLDGFLRMPADIQLELRD 257 Ignisphaer...
jgi:Vdis_0678     179 DFWRKFRKLVSdgvV-SEGDLNRASIEELIVGAHFNVNYFRSIAR---DEVEILSIDRRIQTNLDGLLRLTADVQLEIRD 254 Vulcanisae...
2R85_B            224 ---DITYTVIGNIPIVLRESLLMDVIEAGERVVKAAEELMG-GLWGPFCLEGVFTPDLEFVVFEISARIVAGTNIfv-ng 298 Pyrococcus...
Q8U3N6            265 wqfEPEYTVCGHASSTLRESLLEKVFDMAEKYVEATKKYYPpGIIGPFTLQTAVDKDLNFYIYDVAPRTGGGTNIhmamg 344 Pyrococcus...
A0B858            264 kqiNPEYTVCGHNSATLRESLLEKAFDLAEKYVAATKEYYPpGIIGPFCLQTCVDKDLNFYIYDVAPRIGGGTNIhmavg 343 Methanothr...
AGN25689          270 sqkVPEYTVCGHNSATLRESLLENAFKLAEKYVAAANEYYSpGIIGPFCLQTCVDKDLNFYIYDVAPRIGGGTNVhmnvg 349 Candidatus...
AGI86112          270 dgiIPEYTVCGHNSATLRESLLDKAFEMAEKYVKATQQYYKpGIIGPFCLQTCVDKDLNFYIYDVAPRIGGGTNVhmsvg 349 Candidatus...
HusnBIG:Mpsy_0967 270 hqlTPEYTVCGHNSATLRESLLEEAFALAEKYIEAARKYYDpGVIGPFCLQTCVDKDLNFYIYDVAPRVGGGTNVhmsvg 349 Methanolob...
WP_013897790      270 kqlTPEYTVCGHNTATLRESLLEEVFNLSEKYVKASQKHYKpGIIGPFCLQTCVDKDLNFYIYDVAPRVGGGTNVhmsvg 349 Methanosal...
jgi:Pyrfu_0911    256 v-iIERMIEVGHIPVTIRESMLAKVFPLAERVVEAARKLEPpGIIGPFTLQLIVTPNLDVVVYDVALRVGGGTNSvmawg 334 Pyrolobus ...
jgi:Igag_0271     258 i-mDIEMIEIGHEMATIRESMLEKLFEIGDKFVEATKIIESpGIIGPFTLQLMVTSDLDVVVFDVAPRIGGGTNVhmgig 336 Ignisphaer...
jgi:Vdis_0678     255 y-lDVEMIEIGHEPATIRESELNRLFEVGDRFVKATEEVEPpGVIGPFTLQLIVTSDLDIVVFDVALRIGGGTNIymgvg 333 Vulcanisae...
2R85_B            299 SPYTWLRYDRPVSTGRRIAMEIREAIENDMLEKVLT 334 Pyrococcus furiosus
Q8U3N6            345 HPYGNSLWRKPMSTGRRIALEIKRAIELDELEKVVT 380 Pyrococcus furiosus
A0B858            344 HPYGNALWRTNMSTGRRLAKEVRLAIESDSLRKIVT 379 Methanothrix thermoacetophila PT
AGN25689          350 HAYGNALWRTNMSTGRRLAMEIRRAIEDDRVKEIVT 385 Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
AGI86112          350 HPYGNTLWRTNMSTGRRLSMEVRKAIEQERLEEIIT 385 Candidatus Methanomethylophilus alvus Mx1201
HusnBIG:Mpsy_0967 350 HPYGNTTWRKPMSTGRRMAFEIRRAIETGQLGKIIT 385 Methanolobus psychrophilus R15
WP_013897790      350 HPYGNTLWRKPMSTGRRLAFEIRRAIEMDKLDQIVT 385 Methanosalsum zhilinae
jgi:Pyrfu_0911    335 GQYIHLWHGKPLTLGERIALEIREAIRDGRLPDIVT 370 Pyrolobus fumarii 1A
jgi:Igag_0271     337 SQYSKLYFGKPISMGRRIAMEIRECIELNCIDKIIT 372 Ignisphaera aggregans DSM 17230
jgi:Vdis_0678     334 SQYSKLYFGRPISMGRRVAMEIRECLEGNCLDRVVT 369 Vulcanisaeta distributa DSM 14429
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap