6H9N


Conserved Protein Domain Family
DivIC

?
pfam04977: DivIC 
Septum formation initiator
DivIC from B. subtilis is necessary for both vegetative and sporulation septum formation. These proteins are mainly composed of an amino terminal coiled-coil.
Statistics
?
PSSM-Id: 398576
Aligned: 66 rows
Threshold Bit Score: 37.5796
Threshold Setting Gi: 81715527
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6H9N_B        22 GKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGGQEALEERARNELSMTRPGETFYRLVPD 90 
Q8REE9        25 IKHSLSKKKSTKEEIIAVNKKIEEIKEDIEKYDKKITSLD-DEFEKERVARNMFQMVKENEIIYKYVEK 92  Fusobacterium nucleatum su...
WP_000631735  25 GESGIVVRSQLEESLASLQLDIERLSYENRQLEEKQKILKNDQVALEREAR-RFYLLSENAHIVKFREt 92  Leptospira interrogans
WP_003722746  55 YTKQVLTLKEKKEKQVQVDKKMVAMKDEQDSLNEQIKKL-HNDDYIAKLARSEYYLSKDGEIIFNIPEE 122 Listeria monocytogenes
Q8EU25        55 HVTQRSAKSDKLEEYEQLEEELVQLKNQEANLEEEINLL-QDEDYVLDIARTNYFFSKEGEKIFKLPDE 122 Oceanobacillus iheyensis
P37471        56 VWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKL-KDEDYVTELARRDLFMSGDGEIIFNVEKK 123 Bacillus subtilis subsp. s...
Q81J87        53 FYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKL-NDEEYVLKIARRDYFFSGKGEIIFPVSk- 119 Bacillus cereus ATCC 14579
Q2G0R4        52 LVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNL-NDKDYIEKIARDDYYLSNKGEVIFRLPEd 119 Staphylococcus aureus subs...
Q9KGI5        56 LQTQAKMLEDIQQEKIALEQKLDELHAEQEFLEQEIKNY-NDEEFIAEIARRDYYMTKPGETLFKLPKS 123 Bacillus halodurans
Q8KG24        35 GDFGLVTRISMELENRKLEKLLAEEQEKIVELRSTIKNAY-QPDSVEKVARERFNFHKKGETVFIIREK 102 Chlorobaculum tepidum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap